TkA05G030220 | RubberDandelionOmics

Gene overview

TkA05G030220

Reference: TK1151 Chr: Chr05 Coordinates: 8181587-8185919 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1469 bp · TkA05G030220|TK1151|cDNA

CTGCCACCGTGCTACGTATCATACTAACAAAAAATTCGATCATTGTATGAAAAGCTAACAAACTAATATAATATTCTGAAATACTTGTTGGAAAGCACAAAATTCATTTCTACAATCTTTGCATTACGTACAACCTTCAAAGGATCAATGTTTGTGATATATATACAACATACCTTCTCGCCTAATTTATTCGCAGTTTCGCGCTTACTGTAATTACTTAACAAAATCATCAAACAGAGTTGTCACCCAAGGAGAACATC...

CDS

Download CDS FASTA

1887 bp · TkA05G030220|TK1151|CDS

ATGGGCTCAGATCATTGGTCAGGCACTAGGAATTTAGCGAAAACCCAACTTGGCGGTGTAATTTTCGGTACCAAGAAGACAACAATCAGCGAATGCCTTTCAAAACAACTCTTCGGTTTACCACATCAACACTTCGCATATGTCAAAAAAATCGACCCTGGTCTTCCACTATTCCTATTTAACTACACCGATAGAACACTTTTTGGCATCTTTGAGGCTGCAAGCTCTGGTCAAATGAACATTGACCCATACGCATGGAA...

Protein

Download Protein FASTA

628 aa · TkA05G030220|TK1151|PROTEIN

MGSDHWSGTRNLAKTQLGGVIFGTKKTTISECLSKQLFGLPHQHFAYVKKIDPGLPLFLFNYTDRTLFGIFEAASSGQMNIDPYAWNVDGSQKTPYPAQVQIRVKLQCKPLTELQFRPIITDNYYAQNLFWFELDHAQTNRLLSLLSSQAFSGPCTTFASHGTTKQKNLLPFKSERVCYMPLENGGQLNSAKSLPSNVKDVKSLNGVNEKEAICLKLKELALKRKNAANDVVPEFAARPFADRKDVVNDMSVEHNGSLSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G030220`
TK1151 ID	TkA05G030220
OH-1004 ID	LXL04_019206
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G030220`
Location	Chr05:8181587-8185919 (+)
Description	Similar to Klhl8: Kelch-like protein 8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019206` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component GO:1990756 ubiquitin-like ligase-substrate adaptor activity Molecular Function
KEGG gene cross-reference	hsa:57563 mmu:246293 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.506

Rank 1 · TkA05G030220 · TK1151

Cytoplasm0.482

Rank 2 · TkA05G030220 · TK1151

Cell membrane0.067

Rank 3 · TkA05G030220 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA05G030220 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA05G030220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10539Dev_Cell_Death18-145 aa

PF16046FAM76232-311 aa

PF04102SlyX248-281 aa

PF25994HH_AprE263-311 aa

PF22037PSD13_N263-349 aa

PF30378CEP135_TSGA10_CC264-336 aa

PF12329TMF_DNA_bd265-310 aa

PF25481Nucleoprot-TPR267-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G030220	`PF10539`	Dev_Cell_Death	18	145	4e-49	166.3
TkA05G030220	`PF16046`	FAM76	232	311	0.8	9.8
TkA05G030220	`PF04102`	SlyX	248	281	0.24	12.8
TkA05G030220	`PF25994`	HH_AprE	263	311	0.022	15.6
TkA05G030220	`PF22037`	PSD13_N	263	349	0.029	15.1
TkA05G030220	`PF30378`	CEP135_TSGA10_CC	264	336	0.072	12.1
TkA05G030220	`PF12329`	TMF_DNA_bd	265	310	0.0029	18.3
TkA05G030220	`PF25481`	Nucleoprot-TPR	267	311	0.21	12.4
TkA05G030220	`PF21613`	Pesticin_RB	268	343	0.064	14.0
TkA05G030220	`PF00261`	Tropomyosin	268	336	0.097	12.8
TkA05G030220	`PF04102`	SlyX	285	326	0.24	12.8
TkA05G030220	`PF01344`	Kelch_1	344	371	5.1e-54	180.1
TkA05G030220	`PF24981`	Beta-prop_ATRN-LZTR1	344	357	4.2e-15	56.5
TkA05G030220	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	345	469	2.7e-25	89.7
TkA05G030220	`PF07646`	Kelch_2	345	369	4.9e-22	77.4
TkA05G030220	`PF13415`	Beta-prop_FBX42	346	498	1.5e-15	58.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card