TkA05G030050 | RubberDandelionOmics

Gene overview

TkA05G030050

Reference: TK1151 Chr: Chr05 Coordinates: 8127486-8130920 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1650 bp · TkA05G030050|TK1151|cDNA

TTTTGGTCTTGGTATTTTTCTACATAATATATTCTTCTAAAGCGAGCTCTCAAAATGAATAATCATATAGCGTACTATCATGTCTTTGACTACAGAGTATTAGCAATTATTTTATCAGAAGTACAACACTCCCTCCATTTTCTAGAGCGACAACATGGACACAAAGGAATGCAGCAAGAATAGAGCGTGGCCATATTCTAAGCTCCCATGGCTGACGCCACCTCTAATCTTCATTTTCATATCCTTTACTTCCATTTCTC...

CDS

Download CDS FASTA

1398 bp · TkA05G030050|TK1151|CDS

ATGGACACAAAGGAATGCAGCAAGAATAGAGCGTGGCCATATTCTAAGCTCCCATGGCTGACGCCACCTCTAATCTTCATTTTCATATCCTTTACTTCCATTTCTCCTACAGATTCATCCAGATTTCTCAACAATCATGACACCAATACTTCAAATTACACCAACTCTTCTTCCTTTAAAGGAAATCATCATCGAATTCTACCCAGTTTTCCAAACAAAAAACAGAGCAATTTGCAGAGGATTGAAGCGGGTTTAGCTCA...

Protein

Download Protein FASTA

465 aa · TkA05G030050|TK1151|PROTEIN

MDTKECSKNRAWPYSKLPWLTPPLIFIFISFTSISPTDSSRFLNNHDTNTSNYTNSSSFKGNHHRILPSFPNKKQSNLQRIEAGLAQARASIKKAASMAANQSIDDPDYVPSGSVYRNPNSFHRSYLEMENRFKIFVYEEGDPPIFHSAPCYGILGLEGIFINDIEISRFRTHDPEKAHVYFLPFSIITLINYVYVVGSHDWNHMYNAVRDYIKVINQKYSYWNRSSGADHFMFACHDWGPEISRSVPYLYKNSIRALCN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G030050`
TK1151 ID	TkA05G030050
OH-1004 ID	LXL04_019204
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G030050

Location Chr05:8127486-8130920 (+)

Description Similar to At5g03795: Probable glycosyltransferase At5g03795

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03795`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At3g07620`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`UniProt: Q9LFP3`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At5g33290`	Involved in pectin biosynthesis.	Identification of a xylogalacturonan xylosyltransferase involved in pectin biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.107.050906
`At3g42180`	May be involved in cell wall biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G03795

ath:AT5G11130

ath:AT5G20260

ath:AT5G25310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.736

Rank 1 · TkA05G030050 · TK1151

Endoplasmic reticulum0.091

Rank 2 · TkA05G030050 · TK1151

Cell membrane0.057

Rank 3 · TkA05G030050 · TK1151

Cytoplasm0.041

Rank 4 · TkA05G030050 · TK1151

Extracellular0.038

Rank 5 · TkA05G030050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12420DUF367125-102 aa

PF03016Exostosin_GT47130-410 aa

PF12420DUF3671180-201 aa

PF24785RXYLT1_C246-280 aa

PF12420DUF3671325-352 aa

PF24785RXYLT1_C337-375 aa

PF25771CC_CEP152-bind451-465 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G030050	`PF12420`	DUF3671	25	102	0.83	9.8
TkA05G030050	`PF03016`	Exostosin_GT47	130	410	6.3e-57	193.9
TkA05G030050	`PF12420`	DUF3671	180	201	0.83	9.8
TkA05G030050	`PF24785`	RXYLT1_C	246	280	0.022	14.9
TkA05G030050	`PF12420`	DUF3671	325	352	0.83	9.8
TkA05G030050	`PF24785`	RXYLT1_C	337	375	0.022	14.9
TkA05G030050	`PF25771`	CC_CEP152-bind	451	465	0.32	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFN2`	Arabidopsis thaliana	sp\|Q9FFN2\|GLYT3_ARATH Probable glycosyltransferase At5g03795	59.200%	Swiss-Prot	High
`Q9SSE8`	Arabidopsis thaliana	sp\|Q9SSE8\|GLYT1_ARATH Probable glycosyltransferase At3g07620	52.100%	Swiss-Prot	High
`Q9LFP3`	Arabidopsis thaliana	sp\|Q9LFP3\|GLYT4_ARATH Probable glycosyltransferase At5g11130	49.900%	Swiss-Prot	Medium
`Q94AA9`	Arabidopsis thaliana	sp\|Q94AA9\|XGD1_ARATH Xylogalacturonan beta-1,3-xylosyltransferase	48.500%	Swiss-Prot	Medium
`Q3EAR7`	Arabidopsis thaliana	sp\|Q3EAR7\|GLYT2_ARATH Probable glycosyltransferase At3g42180	46.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card