TkA05G029440 | RubberDandelionOmics

Gene overview

TkA05G029440

Reference: TK1151 Chr: Chr05 Coordinates: 7937841-7941905 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · TkA05G029440|TK1151|cDNA

GGAAAACCAAATTGCAGGTCATGTTTAGGTGCCTACCCACTTCCATTTCACCATCATCCTTCAATCCTACCCTCCATCTATAAAAACTCTTCCATGCCTGAAATCTAGAAATCACACAGCAGTCGTACACTTACCCAATATGCCTTGTCTCCAGATCTCCACCAACGTTTGCCTCGACGGTGTTGACACCGATCCGATCGTCTCTGCAGCCACCAAAGCCGTTTCCGAAATCATCGGCCGCCCTGAGAACTTTGTAATGG...

CDS

Download CDS FASTA

339 bp · TkA05G029440|TK1151|CDS

ATGCCTTGTCTCCAGATCTCCACCAACGTTTGCCTCGACGGTGTTGACACCGATCCGATCGTCTCTGCAGCCACCAAAGCCGTTTCCGAAATCATCGGCCGCCCTGAGAACTTTGTAATGGTGATATTGAAAGGGTCGGTGGACATATCTTTTGAAAGGAACAAAGAGCCCGCAGCATTTGCAGAAATAGTAGCAATGGGAGGCATCACATCTGAAGTAAAAAAGAAATTAATATTTCAATTAGGAACAATTTTACTAGA...

Protein

Download Protein FASTA

112 aa · TkA05G029440|TK1151|PROTEIN

MPCLQISTNVCLDGVDTDPIVSAATKAVSEIIGRPENFVMVILKGSVDISFERNKEPAAFAEIVAMGGITSEVKKKLIFQLGTILLENLSIPRTRLFVKVFDTTMATKYAKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G029440`
TK1151 ID	TkA05G029440
OH-1004 ID	LXL04_000008
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.900
Protein coverage (%)	TK1151 91.071 / OH-1004 89.516 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G029440`
Location	Chr05:7937841-7941905 (-)
Description	Similar to Macrophage migration inhibitory factor homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000008` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0070207 protein homotrimerization Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0004167 dopachrome isomerase activity Molecular Function GO:0005125 cytokine activity Molecular Function GO:0050178 phenylpyruvate tautomerase activity Molecular Function
KEGG gene cross-reference	bmy:BM_BM6870 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.603

Rank 1 · TkA05G029440 · TK1151

Extracellular0.200

Rank 2 · TkA05G029440 · TK1151

Nucleus0.178

Rank 3 · TkA05G029440 · TK1151

Mitochondrion0.090

Rank 4 · TkA05G029440 · TK1151

Cell membrane0.041

Rank 5 · TkA05G029440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01187MIF1-104 aa

PF01361Tautomerase20-43 aa

PF01361Tautomerase65-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G029440	`PF01187`	MIF	1	104	4.2e-13	50.4
TkA05G029440	`PF01361`	Tautomerase	20	43	0.0015	19.1
TkA05G029440	`PF01361`	Tautomerase	65	98	0.0015	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card