TkA05G025780 | RubberDandelionOmics

Gene overview

TkA05G025780

Reference: TK1151 Chr: Chr05 Coordinates: 6986784-6991341 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2409 bp · TkA05G025780|TK1151|cDNA

AAGAAAACAATTGCTTTTTCTAATAATTTATAAACCTTTCTCATGCAGCACCACCACACAACAAATAATCCTTTTTTAATTTGAAGTGTAAGGTGCAATCTCAACAAGCTGTTGTTATGATGTCAATGAAATCAGAGTTTCAAGAGTCGTCTGGAATTGATATATTAATCAGAATATGTACGAAGTAAATCAGCTTTATATAAACGTATATTGGGTTACCCATGGAAGGAGTACAACACTTAAAATTTCCGTTTGACGAT...

CDS

Download CDS FASTA

1053 bp · TkA05G025780|TK1151|CDS

ATGGAAATGTTCTCAATGGTTGCATATCAGTGCCTGAAAGAAAATAGAAGCGAACGCCCTACAATGACTTGGATCCTCGAAAAACTTGAGAAAGCATTGGAACTTCAAGTTGATATTAAAGCTGAAAAACTTATTCGAATTGGAACATGGGGAAGACAAAGTGGAGATTCTCAATATTATTGGTCTTATGAACTTGAGCAAGATTACCATCTTTCGAAGATAACAATAGATCATGGCGACGGGATATACTCCCTCATGTT...

Protein

Download Protein FASTA

350 aa · TkA05G025780|TK1151|PROTEIN

MEMFSMVAYQCLKENRSERPTMTWILEKLEKALELQVDIKAEKLIRIGTWGRQSGDSQYYWSYELEQDYHLSKITIDHGDGIYSLMFTSESRGVVRNSNKVGGWASGDKVSEITFDGDEYIIGVNGTIGTRGGDKIISSLSFKTNKRIHGPFGQAAGESHFSVPWEEGRFVGFYGSAGPYIDSIGVYVKAYEEIIKVGTWGMSKPNTLADTWSLQLERNHHLKNVTIDHGNHIYSIMFTSEHRGLLHTSKLAGGWNGGEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G025780`
TK1151 ID	TkA05G025780
OH-1004 ID	LXL04_019172
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 57.190 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G025780

Location Chr05:6986784-6991341 (-)

Description Similar to At5g39000: Putative receptor-like protein kinase At5g39000

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19715`	Jacalin-related lectin 3.	No verified direct reference in this release
`At1g52070`	Jacalin-related lectin 10.	No verified direct reference in this release
`At1g73040`	Jacalin-related lectin 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019172 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G51550

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · TkA05G025780 · TK1151

Nucleus0.218

Rank 2 · TkA05G025780 · TK1151

Extracellular0.134

Rank 3 · TkA05G025780 · TK1151

Cell membrane0.082

Rank 4 · TkA05G025780 · TK1151

Lysosome / Vacuole0.079

Rank 5 · TkA05G025780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30793DUF874345-89 aa

PF01419Jacalin47-187 aa

PF18708MapZ_C263-98 aa

PF10636hemP72-89 aa

PF09134Invasin_D375-115 aa

PF30793DUF8743145-240 aa

PF01419Jacalin211-345 aa

PF18708MapZ_C2217-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G025780	`PF30793`	DUF8743	45	89	0.068	13.9
TkA05G025780	`PF01419`	Jacalin	47	187	1.3e-53	181.7
TkA05G025780	`PF18708`	MapZ_C2	63	98	0.015	16.3
TkA05G025780	`PF10636`	hemP	72	89	0.02	15.5
TkA05G025780	`PF09134`	Invasin_D3	75	115	0.2	12.9
TkA05G025780	`PF30793`	DUF8743	145	240	0.068	13.9
TkA05G025780	`PF01419`	Jacalin	211	345	1.3e-53	181.7
TkA05G025780	`PF18708`	MapZ_C2	217	248	0.015	16.3
TkA05G025780	`PF10636`	hemP	223	240	0.02	15.5
TkA05G025780	`PF09134`	Invasin_D3	223	245	0.2	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HQX1`	Arabidopsis thaliana	sp\|F4HQX1\|JAL3_ARATH Jacalin-related lectin 3	27.700%	Swiss-Prot	Low
`Q8GWI7`	Arabidopsis thaliana	sp\|Q8GWI7\|JAL10_ARATH Jacalin-related lectin 10	28.000%	Swiss-Prot	Low
`Q9SSM3`	Arabidopsis thaliana	sp\|Q9SSM3\|JAL19_ARATH Jacalin-related lectin 19	39.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card