TkA05G023370 | RubberDandelionOmics

Gene overview

TkA05G023370

Reference: TK1151 Chr: Chr05 Coordinates: 6334868-6338199 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1732 bp · TkA05G023370|TK1151|cDNA

CAGGCAGACGGTGGTAAGTTAGAATTGAAAAAAAAAAAAAAAAAAATCCTCTTGCTTGCTTCATCCTCTTTCTCTCTGTACGATCCTGAGCTCCGACTTGATCCTTTCTCTCCGAAGTCACCATGACTATGCAATCATCTAAACCTCAAGATGGCAAAAACAAGGATTCAAAGAGCTCACACTCCGATCTCCCAGCTTTGAATGTCTCCGATGCATTTCCTCAAGCAACCCCAGCTTCAATCTTTCCACCTTGCACCTCA...

CDS

Download CDS FASTA

456 bp · TkA05G023370|TK1151|CDS

ATGGATTGGAAACAGCACTTTTGCAGATATTTAGTTATTTTTGCTAAAAACAATAACACAAATCAAATAAACGGATTCATCGTAAAAAAGAATGCACCAGGTTTACAAGCTACAAAGATCGAAAACAAAATTGGTCTTAGAATGGTCCAAAATGGAGATATTCTTTTACAGAAAGTCTTTGTCCCTGATGAAGATAGGTTACCTGGAGTCAACTCTTTCCAAGATACAAGCAAAGTTCTTGCGGTTTCTCGTGTGATGGT...

Protein

Download Protein FASTA

151 aa · TkA05G023370|TK1151|PROTEIN

MDWKQHFCRYLVIFAKNNNTNQINGFIVKKNAPGLQATKIENKIGLRMVQNGDILLQKVFVPDEDRLPGVNSFQDTSKVLAVSRVMVAWQPIGITMGVYDMCHRYLLERKQFGAPLAAFQINQQKLVQMLANIQAMFLIGWRLCNCTKVVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G023370`
TK1151 ID	TkA05G023370
OH-1004 ID	LXL04_013021
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	30.200
Protein coverage (%)	TK1151 82.781 / OH-1004 32.576 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G023370

Location Chr05:6334868-6338199 (-)

Description Similar to 2MBCD: 2-methylacyl-CoA dehydrogenase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51840`	Catalyzes the desaturation of short-chain acyl-CoAs to 2- trans-enoyl-CoAs.	Arabidopsis mutants in short- and medium-chain acyl-CoA oxidase activities accumulate acyl-CoAs and reveal that fatty acid beta-oxidation is essential for embryo development.2003 · DOI: 10.1074/jbc.m300826200 Mutations in Arabidopsis acyl-CoA oxidase genes reveal distinct and overlapping roles in beta-oxidation.2005 · DOI: 10.1111/j.1365-313x.2005.02343.x Peroxisomal β-oxidation regulates histone acetylation and DNA methylation in Arabidopsis .2019 · DOI: 10.1073/pnas.1904143116

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013021 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0010230 alternative respiration Biological Process

GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process

GO:1902190 2-methylbutanoyl-CoA(4-) catabolic process Biological Process

GO:1902192 2-methylbut-2-enoyl-CoA(4-) metabolic process Biological Process

GO:1902196 isovaleryl-CoA(4-) catabolic process Biological Process

GO:1902198 3-methylbut-2-enoyl-CoA(4-) metabolic process Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G45300

dosa:Os05g0125500

mmu:56357

sot:102589539

sot:102601763

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.449

Rank 1 · TkA05G023370 · TK1151

Mitochondrion0.249

Rank 2 · TkA05G023370 · TK1151

Cytoplasm0.147

Rank 3 · TkA05G023370 · TK1151

Nucleus0.067

Rank 4 · TkA05G023370 · TK1151

Extracellular0.054

Rank 5 · TkA05G023370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02770Acyl-CoA_dh_M8-59 aa

PF24288DUF747639-98 aa

PF00441Acyl-CoA_dh_177-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G023370	`PF02770`	Acyl-CoA_dh_M	8	59	4e-05	24.4
TkA05G023370	`PF24288`	DUF7476	39	98	0.12	13.0
TkA05G023370	`PF00441`	Acyl-CoA_dh_1	77	143	4.1e-12	47.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96329`	Arabidopsis thaliana	sp\|Q96329\|ACOX4_ARATH Acyl-coenzyme A oxidase 4, peroxisomal	86.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card