TkA05G021040 | RubberDandelionOmics

Gene overview

TkA05G021040

Reference: TK1151 Chr: Chr05 Coordinates: 5759939-5760364 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA05G021040|TK1151|cDNA

ATGTTTGATGAAAACTGGGACCTTCAAATCAATCCTGCCGGCGAACACTTCATTGATCGGAACCCAGATTGTTTTTCAATTCTCTTAGACTTATTACAAACTGGCGAGCTTTACATTCCACCAAACGTACCCGAAAAGCTCCTCTATCGAGAAGCCTTGTTTTACGGCCTCATGGACCATGTCCAGTCCGCGAAATGGGGTCAGTTCGATGGTAACCGTCTTCAGCCTCCAAAATCCGTCACCGGCCGAGCACCAGGCGA...

CDS

Download CDS FASTA

426 bp · TkA05G021040|TK1151|CDS

ATGTTTGATGAAAACTGGGACCTTCAAATCAATCCTGCCGGCGAACACTTCATTGATCGGAACCCAGATTGTTTTTCAATTCTCTTAGACTTATTACAAACTGGCGAGCTTTACATTCCACCAAACGTACCCGAAAAGCTCCTCTATCGAGAAGCCTTGTTTTACGGCCTCATGGACCATGTCCAGTCCGCGAAATGGGGTCAGTTCGATGGTAACCGTCTTCAGCCTCCAAAATCCGTCACCGGCCGAGCACCAGGCGA...

Protein

Download Protein FASTA

141 aa · TkA05G021040|TK1151|PROTEIN

MFDENWDLQINPAGEHFIDRNPDCFSILLDLLQTGELYIPPNVPEKLLYREALFYGLMDHVQSAKWGQFDGNRLQPPKSVTGRAPGDGTAIRASSDGGCYVAYGRMVHIYDWMLEEHPPINLYYQRVNDAGWVGPLTQLGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G021040`
TK1151 ID	TkA05G021040
OH-1004 ID	LXL04_018126
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 99.291 / OH-1004 29.474 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G021040

Location Chr05:5759939-5760364 (-)

Description Similar to At2g24240: BTB/POZ domain-containing protein At2g24240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30940`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g24240`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g09030`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Arabidopsis BTB/POZ protein-dependent PENETRATION3 trafficking and disease susceptibility.2017 · DOI: 10.1038/s41477-017-0039-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018126 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045879 negative regulation of smoothened signaling pathway Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT2G24240

ath:AT3G09030

ath:AT4G30940

ath:AT5G41330

mmu:622320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.349

Rank 1 · TkA05G021040 · TK1151

Cytoplasm0.333

Rank 2 · TkA05G021040 · TK1151

Mitochondrion0.145

Rank 3 · TkA05G021040 · TK1151

Cell membrane0.104

Rank 4 · TkA05G021040 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA05G021040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02214BTB_27-60 aa

PF25279Beta_prop_At2g2424082-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G021040	`PF02214`	BTB_2	7	60	4.6e-08	34.0
TkA05G021040	`PF25279`	Beta_prop_At2g24240	82	134	4.4e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65555`	Arabidopsis thaliana	sp\|O65555\|Y4094_ARATH BTB/POZ domain-containing protein At4g30940	68.400%	Swiss-Prot	High
`Q9ZUH1`	Arabidopsis thaliana	sp\|Q9ZUH1\|Y2424_ARATH BTB/POZ domain-containing protein At2g24240	64.700%	Swiss-Prot	High
`Q9S7R7`	Arabidopsis thaliana	sp\|Q9S7R7\|EAP3_ARATH Protein ENDOPLASMIC RETICULUM-ARRESTED PEN3	27.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card