Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3139 bp · TkA05G020480|TK1151|cDNA
CTTCATTCACTCATAAAACACCTACTGAAAACCCTCTTACGTTCATTTCTTCAACCCAAACATGAAGCCAAATCGCAAGCTCAAGAAACCCCCAACTTCTTGTTCTAAGTTCGATTTGGAAGAGATTATCGGGTTGACGGTGAGGAACGACAACGGATTGGCTTCTAGCACTTCCGATTCCAAGTTTGTATATATAGCAGGATGTGTTGTAGTGCTTTACGACGTCGATTCAGGAACTCAATCGCACCTTATGGAATCTA...
3063 bp · TkA05G020480|TK1151|CDS
ATGAAGCCAAATCGCAAGCTCAAGAAACCCCCAACTTCTTGTTCTAAGTTCGATTTGGAAGAGATTATCGGGTTGACGGTGAGGAACGACAACGGATTGGCTTCTAGCACTTCCGATTCCAAGTTTGTATATATAGCAGGATGTGTTGTAGTGCTTTACGACGTCGATTCAGGAACTCAATCGCACCTTATGGAATCTAATCGTTCGCCCAAGCCTTTCAGCTGTGTTGCCGTCTCTCAAGATGGAAGCTATATTGCAGC...
Protein
Download Protein FASTA1020 aa · TkA05G020480|TK1151|PROTEIN
MKPNRKLKKPPTSCSKFDLEEIIGLTVRNDNGLASSTSDSKFVYIAGCVVVLYDVDSGTQSHLMESNRSPKPFSCVAVSQDGSYIAAGESGQQPSIIVWSSATMASIPELKGHRYGVACMAFSPDGKHLVSVGTPQDGYLCFWDWRSGTLVKKMKACSSFCAVSSVTFSADANFILTAGKRHLKIWTVGLPTKSQAKTKTKTKTVSLTMHGKAVNLGQLKGCTFIAVTSPFKTYGNVADGKGSEPVIVYALTDTGVLCLL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G020480 |
|---|---|
| TK1151 ID | TkA05G020480 |
| OH-1004 ID | LXL04_019125 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 95.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G020480 |
|---|---|
| Location | Chr05:5603989-5608450 (+) |
| Description | Similar to Mapkbp1: Mitogen-activated protein kinase-binding protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007052 mitotic spindle organization Biological Process GO:0007099 centriole replication Biological Process GO:0032717 negative regulation of interleukin-8 production Biological Process GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process GO:0046330 positive regulation of JNK cascade Biological Process GO:0046605 regulation of centrosome cycle Biological Process GO:0097150 neuronal stem cell population maintenance Biological Process GO:1900425 negative regulation of defense response to bacterium Biological Process GO:0000922 spindle pole Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component |
| KEGG gene cross-reference | hsa:23005 hsa:284403 mmu:26390 ssc:100144885 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24780WD40_MABP1-WDR62_1st32-364 aaPF23414Beta-prop_EML_232-206 aaPF24506KNTC1_N35-90 aaPF23381Beta-prop_IFT122_1st36-132 aaPF30552CFAP251_N37-145 aaPF23393Beta-prop_WDR90_POC16_2nd42-134 aaPF24814WD40_Prp1947-205 aaPF25175Beta-prop_WDR548-188 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G020480 | PF24780 | WD40_MABP1-WDR62_1st | 32 | 364 | 4.2e-63 | 214.3 |
| TkA05G020480 | PF23414 | Beta-prop_EML_2 | 32 | 206 | 1.2e-36 | 127.2 |
| TkA05G020480 | PF24506 | KNTC1_N | 35 | 90 | 0.052 | 13.5 |
| TkA05G020480 | PF23381 | Beta-prop_IFT122_1st | 36 | 132 | 8.4e-42 | 144.1 |
| TkA05G020480 | PF30552 | CFAP251_N | 37 | 145 | 3.9e-25 | 89.5 |
| TkA05G020480 | PF23393 | Beta-prop_WDR90_POC16_2nd | 42 | 134 | 1.5e-25 | 90.8 |
| TkA05G020480 | PF24814 | WD40_Prp19 | 47 | 205 | 8e-44 | 150.5 |
| TkA05G020480 | PF25175 | Beta-prop_WDR5 | 48 | 188 | 8e-42 | 144.2 |
| TkA05G020480 | PF24817 | WD40_WDHD1_1st | 48 | 162 | 1.2e-36 | 127.2 |
| TkA05G020480 | PF23410 | Beta-prop_VPS8 | 48 | 114 | 3.9e-13 | 49.9 |
| TkA05G020480 | PF24782 | WD40_MABP1-WDR62_2nd | 49 | 143 | 5.9e-76 | 256.3 |
| TkA05G020480 | PF25173 | Beta-prop_WDR3_1st | 49 | 210 | 6.4e-52 | 176.6 |
| TkA05G020480 | PF25174 | Beta-prop_THOC3 | 49 | 210 | 3.5e-43 | 148.3 |
| TkA05G020480 | PF23389 | Beta-prop_WDR19_1st | 49 | 126 | 2e-06 | 27.8 |
| TkA05G020480 | PF24807 | WD40_CDC20-Fz | 50 | 189 | 3.7e-28 | 99.4 |
| TkA05G020480 | PF24796 | WDR55 | 50 | 224 | 2.5e-23 | 83.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.