TkA05G016520 | RubberDandelionOmics

Gene overview

TkA05G016520

Reference: TK1151 Chr: Chr05 Coordinates: 4649594-4651834 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1897 bp · TkA05G016520|TK1151|cDNA

ATATAAATTGCACAAAACAAAACCACCCGTGAGAATATCCGTATCAGGCGAGTGACCCGGTCGTATCAGGCGGTTATCCCAATCTCCCACTCTCTGATCCCCTCCATTTGTCAAGAACCCTAACCCTATATCAGAACATATCAGAATCCACGTCACAGATGAAAGGGGAAGTGAGCAACCTTTTTTGTTCGATCACCCTATCATGTCCCAAGCCGATGTCTCTTACAGTTGCGGTTCATGTGGATACCCTCTGAATCTTG...

CDS

Download CDS FASTA

1131 bp · TkA05G016520|TK1151|CDS

ATGGAGTTTTGTCTTCCCGATGATTGTCTAACTTTCATTTTCAAAAAACTTGATTCGAGTACAGATCGAGACTCTTTCGGTCTAACTTGTCATCGATTTCTTCAAATCCAAAACCCAAACCGTAAATCACTGGAATTCGCATGTTCATTTTCTCGATCCAACCTCTCTGAAACCACCATCAACATCGATTCCTTCATTCTTGACAAGTTAATCAAACGTTTCACAAATCTAAACTCATTAAACTTATGCGGGTGTGTAAA...

Protein

Download Protein FASTA

376 aa · TkA05G016520|TK1151|PROTEIN

MEFCLPDDCLTFIFKKLDSSTDRDSFGLTCHRFLQIQNPNRKSLEFACSFSRSNLSETTINIDSFILDKLIKRFTNLNSLNLCGCVNLQDSGLIQLTNHGSKLHSLYLDCCFNITDSGLSHIALGCQSLSSISLYRCPITDKGLHHLSKSCSSLKDINLEWCSLVTDTGISAITANCRHLRAVKISHCDKIKGVGFTGCSKTLSCLEADSCKIDPEGITGILSGGGLEYLNVSCLSWCIYGDGLRSIGGGFGKNIRVLDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G016520`
TK1151 ID	TkA05G016520
OH-1004 ID	LXL04_019073
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G016520

Location Chr05:4649594-4651834 (+)

Description Similar to FBL12: F-box/LRR-repeat protein 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07550`	F-box/LRR-repeat protein 12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019073 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010225 response to UV-C Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT3G07550

ath:AT4G15475

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.782

Rank 1 · TkA05G016520 · TK1151

Cytoplasm0.142

Rank 2 · TkA05G016520 · TK1151

Mitochondrion0.054

Rank 3 · TkA05G016520 · TK1151

Plastid0.042

Rank 4 · TkA05G016520 · TK1151

Cell membrane0.028

Rank 5 · TkA05G016520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like4-36 aa

PF00646F-box4-36 aa

PF29594LRR_SKP254-111 aa

PF24758LRR_At5g5637054-136 aa

PF23622LRR_At1g61320_AtMIF169-115 aa

PF12799LRR_469-85 aa

PF23952LRR_EndoS71-90 aa

PF25372LRR_FBXL1574-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G016520	`PF12937`	F-box-like	4	36	0.0071	16.8
TkA05G016520	`PF00646`	F-box	4	36	0.025	15.2
TkA05G016520	`PF29594`	LRR_SKP2	54	111	3.7e-13	50.1
TkA05G016520	`PF24758`	LRR_At5g56370	54	136	0.16	12.3
TkA05G016520	`PF23622`	LRR_At1g61320_AtMIF1	69	115	0.001	19.2
TkA05G016520	`PF12799`	LRR_4	69	85	0.02	15.9
TkA05G016520	`PF23952`	LRR_EndoS	71	90	0.11	13.4
TkA05G016520	`PF25372`	LRR_FBXL15	74	188	4.4e-14	52.5
TkA05G016520	`PF13516`	LRR_6	75	94	3.1e-14	52.5
TkA05G016520	`PF12799`	LRR_4	75	117	0.02	15.9
TkA05G016520	`PF00560`	LRR_1	76	87	5.3	8.4
TkA05G016520	`PF24758`	LRR_At5g56370	90	188	0.16	12.3
TkA05G016520	`PF23622`	LRR_At1g61320_AtMIF1	98	194	0.001	19.2
TkA05G016520	`PF13516`	LRR_6	102	123	3.1e-14	52.5
TkA05G016520	`PF12799`	LRR_4	102	141	0.02	15.9
TkA05G016520	`PF00560`	LRR_1	102	113	5.3	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRR1`	Arabidopsis thaliana	sp\|Q9SRR1\|FBL12_ARATH F-box/LRR-repeat protein 12	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card