TkA05G016030 | RubberDandelionOmics

Gene overview

TkA05G016030

Reference: TK1151 Chr: Chr05 Coordinates: 4540978-4544012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1504 bp · TkA05G016030|TK1151|cDNA

CGAACACAACGGCCACCTTTTATTCCTTTGGACGCTATCATCTTGCCCACTCGCGCCAAATCCATCGAAGAAAAATGGCTGCCATTCTTCACATCTCTTCTCTTCATTCTAACACTCCTCCGTTCCCCCTCCATTCCCTCACACCATCTCCGCCCTCCCTCCGCCATAGCTCCCTCCAATCGAAGGCTCACGTCGACATCCTTCTCCAAAGAAGAAAGAGACCGATAGCCTTCACCTGCCAATCCACCAATGACGATGGC...

CDS

Download CDS FASTA

846 bp · TkA05G016030|TK1151|CDS

ATGCTCTGTATATATAATTTTTGCACTAGATGGTTTTGCGTTGAAAGTGGAAATGTTGATAAACCTACAGTTGTATTAATTCATGGATTCCCTTCACAGGCTTATTCATACCGCAAAGTACTGCCACAGCTATCCAAGGATTATCATACTATTGCTTTTGACTGGTTAGGCTTTGGATATTCAGATAAGCCTCAACCCAAATATGGATTTGATTATACCTTAGATGAATTTGTGTCAGCTTTGGGATCTGTTATTGATGA...

Protein

Download Protein FASTA

281 aa · TkA05G016030|TK1151|PROTEIN

MLCIYNFCTRWFCVESGNVDKPTVVLIHGFPSQAYSYRKVLPQLSKDYHTIAFDWLGFGYSDKPQPKYGFDYTLDEFVSALGSVIDELGVDKVSLVVQGYFAPIVVKYASNHQENVNDLILLNPPLTDKHANLPSTLSIFSNFLLGEIFSQDPLRASDKTLTSCGPYKMKENDAMVYRRPYLTSGSSGFALNAISRSMKKELKNSVEEMRKILMDDDWKVKTSICWGQRDRWLDFDGVEDFCNASKHRLVQLPMAGHHVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G016030`
TK1151 ID	TkA05G016030
OH-1004 ID	LXL04_019068
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 96.797 / OH-1004 66.995 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G016030`
Location	Chr05:4540978-4544012 (-)
Description	Similar to ceeh-1: Epoxide hydrolase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019068` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0016829 lyase activity Molecular Function GO:0018786 haloalkane dehalogenase activity Molecular Function
KEGG gene cross-reference	cel:CELE_K02F3.6 mbo:BQ2027_MB1864C mtc:MT1881 mtu:Rv1833c mtv:RVBD_1833c son:SO_1743 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.255

Rank 1 · TkA05G016030 · TK1151

Endoplasmic reticulum0.254

Rank 2 · TkA05G016030 · TK1151

Mitochondrion0.166

Rank 3 · TkA05G016030 · TK1151

Lysosome / Vacuole0.139

Rank 4 · TkA05G016030 · TK1151

Nucleus0.125

Rank 5 · TkA05G016030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_421-251 aa

PF00561Abhydrolase_122-262 aa

PF12697Abhydrolase_624-261 aa

PF03096Ndr73-125 aa

PF06821Ser_hydrolase75-142 aa

PF06821Ser_hydrolase215-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G016030	`PF12146`	Hydrolase_4	21	251	2.6e-09	37.5
TkA05G016030	`PF00561`	Abhydrolase_1	22	262	2.4e-23	83.8
TkA05G016030	`PF12697`	Abhydrolase_6	24	261	1.3e-08	36.5
TkA05G016030	`PF03096`	Ndr	73	125	0.0022	17.5
TkA05G016030	`PF06821`	Ser_hydrolase	75	142	0.17	12.5
TkA05G016030	`PF06821`	Ser_hydrolase	215	258	0.17	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card