RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G015410
Reference: TK1151 Chr: Chr05 Coordinates: 4358724-4362472 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2013 bp · TkA05G015410|TK1151|cDNA

ATGGAGTCATGGATAGGGAAGTCCATTCACAGGTGCATTACCATGGCGATATCAGATATTTATGCTCTTAATCACAATTACAAAACTAAGATAGTTATTCACACTAGGGATTCCAAAGGAGATCCACTAAAAGCTCTTTCCGCTGTACAGCATCTTCTGAAAAAAGCGAATGTGCAAGCTATCATAGGCCCAGAGACGCATCTTCAATCGAAGTTATTGTCCACGTTGGATGATAAAGCTAAAATTCCAATATTTTCTTT...

CDS

Download CDS FASTA

2013 bp · TkA05G015410|TK1151|CDS

ATGGAGTCATGGATAGGGAAGTCCATTCACAGGTGCATTACCATGGCGATATCAGATATTTATGCTCTTAATCACAATTACAAAACTAAGATAGTTATTCACACTAGGGATTCCAAAGGAGATCCACTAAAAGCTCTTTCCGCTGTACAGCATCTTCTGAAAAAAGCGAATGTGCAAGCTATCATAGGCCCAGAGACGCATCTTCAATCGAAGTTATTGTCCACGTTGGATGATAAAGCTAAAATTCCAATATTTTCTTT...

Protein

Download Protein FASTA

670 aa · TkA05G015410|TK1151|PROTEIN

MESWIGKSIHRCITMAISDIYALNHNYKTKIVIHTRDSKGDPLKALSAVQHLLKKANVQAIIGPETHLQSKLLSTLDDKAKIPIFSFASPSSRKDPYLFQIKQDESTMASKSIAALVNSYNWRDVIFVHEDTDDGREILQYLAESFHDKNIRISYRTSISASDTHDEITEELRKIMTFHTTVIIIHMSPSLASNLFLNAKRKNSTLVTKEVPVPSLWVYDTIWALAESIEKVGVPHNGSMLLHEILKIRFKGISGDFQLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G015410
TK1151 IDTkA05G015410
OH-1004 IDLXL04_019058
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)81.000
Protein coverage (%)TK1151 99.403 / OH-1004 89.781
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G015410
LocationChr05:4358724-4362472 (+)
DescriptionSimilar to GLR1.3: Glutamate receptor 1.3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g48400 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release
At5g48410 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release
At3g07520 Glutamate-gated receptor that probably acts as a non-selective cation channel.
Arabidopsis thaliana glutamate receptor ion channel function demonstrated by ion pore transplantation.2008 · DOI: 10.1016/j.jmb.2008.06.076
At3g04110 Glutamate-gated receptor that probably acts as a non-selective cation channel.
The putative glutamate receptor 1.1 (AtGLR1.1) functions as a regulator of carbon and nitrogen metabolism in Arabidopsis thaliana.2003 · DOI: 10.1073/pnas.1030961100
The putative glutamate receptor 1.1 (AtGLR1.1) in Arabidopsis thaliana regulates abscisic acid biosynthesis and signaling to control development and water loss.2004 · DOI: 10.1093/pcp/pch159
Arabidopsis thaliana glutamate receptor ion channel function demonstrated by ion pore transplantation.2008 · DOI: 10.1016/j.jmb.2008.06.076
At4g31710 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019058 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006816 calcium ion transport Biological Process
GO:0006874 intracellular calcium ion homeostasis Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0019722 calcium-mediated signaling Biological Process
GO:0030003 intracellular monoatomic cation homeostasis Biological Process
GO:0071230 cellular response to amino acid stimulus Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004930 G protein-coupled receptor activity Molecular Function
GO:0005261 monoatomic cation channel activity Molecular Function
GO:0005262 calcium channel activity Molecular Function
GO:0008066 glutamate receptor activity Molecular Function
KEGG gene cross-reference
ath:AT2G29120
ath:AT3G07520
ath:AT5G11210
ath:AT5G48400
ath:AT5G48410
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.769
Rank 1 · TkA05G015410 · TK1151
Cytoplasm0.080
Rank 2 · TkA05G015410 · TK1151
Endoplasmic reticulum0.077
Rank 3 · TkA05G015410 · TK1151
Extracellular0.059
Rank 4 · TkA05G015410 · TK1151
Lysosome / Vacuole0.041
Rank 5 · TkA05G015410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13458Peripla_BP_66-202 aa
PF01094ANF_receptor12-203 aa
PF19098DUF5785130-182 aa
PF01094ANF_receptor201-273 aa
PF10613Lig_chan-Glu_bd333-372 aa
PF00497SBP_bac_3354-383 aa
PF00497SBP_bac_3381-641 aa
PF10613Lig_chan-Glu_bd418-454 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G015410PF13458Peripla_BP_662022.5e-1144.5
TkA05G015410PF01094ANF_receptor122033e-49168.7
TkA05G015410PF19098DUF57851301820.2612.5
TkA05G015410PF01094ANF_receptor2012733e-49168.7
TkA05G015410PF10613Lig_chan-Glu_bd3333723.8e-0524.5
TkA05G015410PF00497SBP_bac_33543831.5e-1144.9
TkA05G015410PF00497SBP_bac_33816411.5e-1144.9
TkA05G015410PF10613Lig_chan-Glu_bd4184543.8e-0524.5
TkA05G015410PF00060Lig_chan4675571.5e-1764.5
TkA05G015410PF26161DUF80444704863.28.6
TkA05G015410PF14296O-ag_pol_Wzy4965410.1911.1
TkA05G015410PF26161DUF80444995453.28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LV72Arabidopsis thalianasp|Q9LV72|GLR12_ARATH Glutamate receptor 1.232.600%Swiss-ProtMedium
Q9FH75Arabidopsis thalianasp|Q9FH75|GLR13_ARATH Glutamate receptor 1.333.100%Swiss-ProtMedium
Q8LGN1Arabidopsis thalianasp|Q8LGN1|GLR14_ARATH Glutamate receptor 1.432.500%Swiss-ProtMedium
Q9M8W7Arabidopsis thalianasp|Q9M8W7|GLR11_ARATH Glutamate receptor 1.131.800%Swiss-ProtMedium
O81776Arabidopsis thalianasp|O81776|GLR24_ARATH Glutamate receptor 2.429.600%Swiss-ProtLow

JBrowse

View in Genome Browser