TkA05G012820 | RubberDandelionOmics

Gene overview

TkA05G012820

Reference: TK1151 Chr: Chr05 Coordinates: 3663839-3668203 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2008 bp · TkA05G012820|TK1151|cDNA

TTTCCACCCATTTCTCACATAAAAAGTGAAATCTACGCAATCGAAACAGAACTACAGAAAGTATTGAAGAAGAAAGAAGTGTTGGAATGGCGGATTACAAAATCAAATTGAATTCTATTGATCTCTCCTCCCCTCATATCCCGACCTCTGTATCCCTACTCAAACAGGTTTCCCCCCTCTCTCTCACTCTTCCGCAAGGGCTTCTGTTGTTTATTCAGGGGAAGTGAAAGAATTTGCGTTCTTATTGGTGTGTGTTCGTA...

CDS

Download CDS FASTA

927 bp · TkA05G012820|TK1151|CDS

ATGTGCATGTGCATTGAGAAGGAGGCATGCATGGATTCCGGTTTCTTCTATGTAACAAATCACGGAATCAGTGAGGAATTCATGGATGAAGTTTTTGCGGAAAGCAAGAAGTTCTTTGATCTTCCATTAGAGGAGAAAATGAAGCTTCTTAGAAATGAGAAACACCGAGGTTACACTCCTGTTCTTGATGAACTTCTTGATCCGGCCAATCAAATCCATGGTGATCATAAGGAGGGATTTTATATTGGTATCGAGCTTCC...

Protein

Download Protein FASTA

308 aa · TkA05G012820|TK1151|PROTEIN

MCMCIEKEACMDSGFFYVTNHGISEEFMDEVFAESKKFFDLPLEEKMKLLRNEKHRGYTPVLDELLDPANQIHGDHKEGFYIGIELPEDDPEAQRTFYGPNLWPNSDILPGWRETMEKYHQHALEVVKKIARLIALSLDLDADFFEQPEMLGKPIAVLRLLHYGVVGQVSDPSKGIYGAGAHSDYGLITLLATDSVSGLQICKDKDTEPRVWESVEPLKGAFVVNLGDMLERWSNCIFRSTLHRVLGNGQERYSIPYFVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G012820`
TK1151 ID	TkA05G012820
OH-1004 ID	LXL04_019036
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 97.727 / OH-1004 90.332 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G012820

Location Chr05:3663839-3668203 (-)

Description Similar to hxnY: 2-oxoglutarate-Fe(II) type oxidoreductase hxnY (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0245500`	2-oxoglutarate-dependent dioxygenase catalyzing homoarginine 6-hydroxylation thus producing 6-hydroxy-L-homoarginine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019036 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0044283 small molecule biosynthetic process Biological Process

GO:1900602 endocrocin biosynthetic process Biological Process

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

afm:AFUA_4G00230

ddi:DDB_G0283291

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.723

Rank 1 · TkA05G012820 · TK1151

Nucleus0.282

Rank 2 · TkA05G012820 · TK1151

Peroxisome0.078

Rank 3 · TkA05G012820 · TK1151

Mitochondrion0.076

Rank 4 · TkA05G012820 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA05G012820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N8-105 aa

PF031712OG-FeII_Oxy108-128 aa

PF031712OG-FeII_Oxy161-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G012820	`PF14226`	DIOX_N	8	105	7e-33	114.5
TkA05G012820	`PF03171`	2OG-FeII_Oxy	108	128	6.3e-23	81.7
TkA05G012820	`PF03171`	2OG-FeII_Oxy	161	261	6.3e-23	81.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6K332`	Oryza sativa subsp. japonica	sp\|Q6K332\|ODD33_ORYSJ Homoarginine-6-hydroxylase 2-ODD-233	35.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card