TkA05G008550 | RubberDandelionOmics

Gene overview

TkA05G008550

Reference: TK1151 Chr: Chr05 Coordinates: 2524688-2528495 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2649 bp · TkA05G008550|TK1151|cDNA

TACAAAGCAAGTACGCACAAAATGAAGCCCACTATAATCCACTACCATGAAAGATAATCCTCGAAAGATATTATTTCTTGTTGCATTATAAACATTATACATGTATGGATGGACGTGGTACAGATAGAAATCCATAACTTTGAAGATTGAATATACAAGTCCATATTGAGAGGTACAAGTAACAAACCACACATGCATGACGTCATTAGAACGTAAATGGCAACAAATAATTTTGTGAGAGATTACTAACAACAAACTAT...

CDS

Download CDS FASTA

1779 bp · TkA05G008550|TK1151|CDS

ATGGAGTTGTCTTCGGTTGAATCAGAAAGTGTCTCAAAACAAGGATCAAATCTAAAAGGAGGTCTTCGAACTATGCCGTTTATCATAGTAAACGAGGGATTTGAAAGGGTGGCAAGTGTTGGGCTTCGTGCAAATATGATCTTGTACCTGAAAAACGAGTATCACTTAAGCAACGCAACTGGAGCAAGCATCTTGTTCTTATGGGGAGCCATCTCAAATTTCATGCCCACTTTGGGAGCTTTTCTATCCGATTCGTATCT...

Protein

Download Protein FASTA

592 aa · TkA05G008550|TK1151|PROTEIN

MELSSVESESVSKQGSNLKGGLRTMPFIIVNEGFERVASVGLRANMILYLKNEYHLSNATGASILFLWGAISNFMPTLGAFLSDSYLGRFRVIGIGSIISLIGMTMVWLTTIFPAARPRTCDQMVDQNCTKPNHMQLALLFISFAVMSIGSGGIRPCSLAFGADQFDRPENPENPKILQRFFNWYYASVGISVMISVTVVVYIQTEKGWILGFGVPAVLMLCSTIMFFMGSSLYIKVKANKSLFSSLFQVVAASFKNRHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G008550`
TK1151 ID	TkA05G008550
OH-1004 ID	LXL04_032133
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.400
Protein coverage (%)	TK1151 92.061 / OH-1004 93.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G008550

Location Chr05:2524688-2528495 (-)

Description Similar to NPF1.2: Protein NRT1/ PTR FAMILY 1.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52190`	Low-affinity nitrate transporter involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves.	Two phloem nitrate transporters, NRT1.11 and NRT1.12, are important for redistributing xylem-borne nitrate to enhance plant growth.2013 · DOI: 10.1104/pp.113.226563
`At3g16180`	Low-affinity nitrate transporter involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves.	No verified direct reference in this release
`At1g69870`	Low-affinity proton-dependent nitrate transporter.	The Arabidopsis nitrate transporter NRT1.7, expressed in phloem, is responsible for source-to-sink remobilization of nitrate.2009 · DOI: 10.1105/tpc.109.067603
`At1g27080`	Low-affinity proton-dependent nitrate transporter.	No verified direct reference in this release
`At5g62680`	High-affinity, proton-dependent glucosinolate-specific transporter.	NRT/PTR transporters are essential for translocation of glucosinolate defence compounds to seeds.2012 · DOI: 10.1038/nature11285 Integration of biosynthesis and long-distance transport establish organ-specific glucosinolate profiles in vegetative Arabidopsis.2013 · DOI: 10.1105/tpc.113.110890

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032133 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010098 suspensor development Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0043562 cellular response to nitrogen levels Biological Process

GO:0048316 seed development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G27080

ath:AT1G52190

ath:AT1G69870

ath:AT3G16180

ath:AT5G11570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.730

Rank 1 · TkA05G008550 · TK1151

Lysosome / Vacuole0.093

Rank 2 · TkA05G008550 · TK1151

Endoplasmic reticulum0.078

Rank 3 · TkA05G008550 · TK1151

Cytoplasm0.073

Rank 4 · TkA05G008550 · TK1151

Mitochondrion0.034

Rank 5 · TkA05G008550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_146-504 aa

PF00854PTR290-524 aa

PF07690MFS_1454-574 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G008550	`PF07690`	MFS_1	46	504	9.3e-15	55.1
TkA05G008550	`PF00854`	PTR2	90	524	2.2e-80	271.2
TkA05G008550	`PF07690`	MFS_1	454	574	9.3e-15	55.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M817`	Arabidopsis thaliana	sp\|Q9M817\|PTR6_ARATH Protein NRT1/ PTR FAMILY 1.2	50.200%	Swiss-Prot	High
`Q8LPL2`	Arabidopsis thaliana	sp\|Q8LPL2\|PTR32_ARATH Protein NRT1/ PTR FAMILY 1.1	52.000%	Swiss-Prot	High
`Q8RX77`	Arabidopsis thaliana	sp\|Q8RX77\|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13	39.900%	Swiss-Prot	Medium
`Q9LFX9`	Arabidopsis thaliana	sp\|Q9LFX9\|PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12	38.900%	Swiss-Prot	Medium
`Q9LV10`	Arabidopsis thaliana	sp\|Q9LV10\|PTR53_ARATH Protein NRT1/ PTR FAMILY 2.11	36.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card