TkA05G008180 | RubberDandelionOmics

Gene overview

TkA05G008180

Reference: TK1151 Chr: Chr05 Coordinates: 2381182-2382706 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · TkA05G008180|TK1151|cDNA

ATGGAAGTTTGTTTGGATCTCTGCAATTCTCACGCTTTTCCTTCACTTGTAGTTAGGGATTCGTTGCATGTGTTGCCACAAGAGATGTTTGGGATATCAACTTTTGGGCTGTCGATGTGGCTGCTCAAGTGGTTCCCTGTGCGAATCGTCGATCATCTCTTGCTTTTCATATCACGCTGTCTGCTCGGTGACACCAGTGTTCTCGGCCTTAATCGCCCCAAAATTGGACCACTCGAGCTAAAAGGCATTTCTGGCAAAAC...

CDS

Download CDS FASTA

633 bp · TkA05G008180|TK1151|CDS

ATGGAAGTTTGTTTGGATCTCTGCAATTCTCACGCTTTTCCTTCACTTGTAGTTAGGGATTCGTTGCATGTGTTGCCACAAGAGATGTTTGGGATATCAACTTTTGGGCTGTCGATGTGGCTGCTCAAGTGGTTCCCTGTGCGAATCGTCGATCATCTCTTGCTTTTCATATCACGCTGTCTGCTCGGTGACACCAGTGTTCTCGGCCTTAATCGCCCCAAAATTGGACCACTCGAGCTAAAAGGCATTTCTGGCAAAAC...

Protein

Download Protein FASTA

210 aa · TkA05G008180|TK1151|PROTEIN

MEVCLDLCNSHAFPSLVVRDSLHVLPQEMFGISTFGLSMWLLKWFPVRIVDHLLLFISRCLLGDTSVLGLNRPKIGPLELKGISGKTPVLDVGTLAKIRSGDIKVYPAIKRLECNIVEFVDGRKENFDAIILATGYRSNVPTWLKDTNLFSNKDGFPKKKLQEGSKGERGLYAVGFTKRGLLGSSIDACRVAKEISRQYSEGKRECLQRA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G008180`
TK1151 ID	TkA05G008180
OH-1004 ID	LXL04_018990
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 50.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G008180

Location Chr05:2381182-2382706 (-)

Description Similar to YUC2: Indole-3-pyruvate monooxygenase YUCCA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25620`	Involved in auxin biosynthesis via the indole-3-pyruvic acid (IPA) pathway.	Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106 yucca6, a dominant mutation in Arabidopsis, affects auxin accumulation and auxin-related phenotypes.2007 · DOI: 10.1104/pp.107.104935 Overexpression of Arabidopsis YUCCA6 in potato results in high-auxin developmental phenotypes and enhanced resistance to water deficit.2013 · DOI: 10.1093/mp/sss100 The biochemical mechanism of auxin biosynthesis by an arabidopsis YUCCA flavin-containing monooxygenase.2013 · DOI: 10.1074/jbc.m112.424077
`At4g13260`	Involved in auxin biosynthesis.	Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106
`At5g11320`	Involved in auxin biosynthesis.	Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106 Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0224700`	Involved in auxin biosynthesis in anthers.	OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0
`Os01g0645400`	Involved in auxin biosynthesis.	Auxin biosynthesis by the YUCCA genes in rice.2007 · DOI: 10.1104/pp.106.091561

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018990 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009819 drought recovery Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G04180

ath:AT1G04610

ath:AT4G13260

ath:AT5G11320

ath:AT5G25620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.319

Rank 1 · TkA05G008180 · TK1151

Cytoplasm0.248

Rank 2 · TkA05G008180 · TK1151

Mitochondrion0.124

Rank 3 · TkA05G008180 · TK1151

Nucleus0.114

Rank 4 · TkA05G008180 · TK1151

Lysosome / Vacuole0.077

Rank 5 · TkA05G008180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00743FMO-like81-142 aa

PF13738Pyr_redox_3116-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G008180	`PF00743`	FMO-like	81	142	0.0018	17.5
TkA05G008180	`PF13738`	Pyr_redox_3	116	175	0.12	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ59`	Arabidopsis thaliana	sp\|Q8VZ59\|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6	66.700%	Swiss-Prot	High
`Q9SVQ1`	Arabidopsis thaliana	sp\|Q9SVQ1\|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2	70.700%	Swiss-Prot	High
`Q9LFM5`	Arabidopsis thaliana	sp\|Q9LFM5\|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4	55.300%	Swiss-Prot	High
`Q9LG41`	Oryza sativa subsp. japonica	sp\|Q9LG41\|YUC4_ORYSJ Indole-3-pyruvate monooxygenase YUCCA4	61.500%	Swiss-Prot	High
`A0A0P0V5U9`	Oryza sativa subsp. japonica	sp\|A0A0P0V5U9\|YUC1_ORYSJ Indole-3-pyruvate monooxygenase YUCCA1	55.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card