TkA05G007160 | RubberDandelionOmics

Gene overview

TkA05G007160

Reference: TK1151 Chr: Chr05 Coordinates: 2110546-2111015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA05G007160|TK1151|cDNA

ATGGAACAAATGAAGGAAAGATTTGCAAGGTTGCTTTTGGGAGAAGATATGTCGGGTCATGGCAATGGGGTTTCATCAGCTTTGGCTTTATCCAATGCAATTACAAATCTAGCTGCTTCTGTATTTGGAAAACAGAATAAATTAGCTCCAATGCCAGAACACTTAAAAAATAGATGGAGAAAAGAACTTGATTGGCTCCTATCAGTGACCGATAACATCGTCGAGTTTGTTCCCTCTCAACAGCAAGGAAAAGACGGATC...

CDS

Download CDS FASTA

372 bp · TkA05G007160|TK1151|CDS

ATGGAACAAATGAAGGAAAGATTTGCAAGGTTGCTTTTGGGAGAAGATATGTCGGGTCATGGCAATGGGGTTTCATCAGCTTTGGCTTTATCCAATGCAATTACAAATCTAGCTGCTTCTGTATTTGGAAAACAGAATAAATTAGCTCCAATGCCAGAACACTTAAAAAATAGATGGAGAAAAGAACTTGATTGGCTCCTATCAGTGACCGATAACATCGTCGAGTTTGTTCCCTCTCAACAGCAAGGAAAAGACGGATC...

Protein

Download Protein FASTA

123 aa · TkA05G007160|TK1151|PROTEIN

MEQMKERFARLLLGEDMSGHGNGVSSALALSNAITNLAASVFGKQNKLAPMPEHLKNRWRKELDWLLSVTDNIVEFVPSQQQGKDGSNMEVIYTYFSCFYVSSIFIKLYPSTYIFYFYFCRLW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G007160`
TK1151 ID	TkA05G007160
OH-1004 ID	LXL04_018981
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 76.423 / OH-1004 20.751 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G007160

Location Chr05:2110546-2111015 (+)

Description Similar to ROPGEF8: Rho guanine nucleotide exchange factor 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79860`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	A distinct mechanism regulating a pollen-specific guanine nucleotide exchange factor for the small GTPase Rop in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705874104
`At3g24620`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	Structural evidence for a common intermediate in small G protein-GEF reactions.2007 · DOI: 10.1016/j.molcel.2006.11.023
`At1g52240`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	A small GTPase activator protein interacts with cytoplasmic phytochromes in regulating root development.2010 · DOI: 10.1074/jbc.m110.133710
`At4g13240`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release
`At3g16130`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018981 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0048364 root development Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT1G52240

ath:AT1G79860

ath:AT3G24620

ath:AT4G13240

ath:AT5G19560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.347

Rank 1 · TkA05G007160 · TK1151

Cytoplasm0.344

Rank 2 · TkA05G007160 · TK1151

Mitochondrion0.169

Rank 3 · TkA05G007160 · TK1151

Endoplasmic reticulum0.150

Rank 4 · TkA05G007160 · TK1151

Cell membrane0.116

Rank 5 · TkA05G007160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03759PRONE1-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G007160	`PF03759`	PRONE	1	94	1.1e-44	153.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA89`	Arabidopsis thaliana	sp\|Q9CA89\|ROGFC_ARATH Rop guanine nucleotide exchange factor 12	74.500%	Swiss-Prot	High
`Q9LV40`	Arabidopsis thaliana	sp\|Q9LV40\|ROGF8_ARATH Rho guanine nucleotide exchange factor 8	73.400%	Swiss-Prot	High
`Q9M811`	Arabidopsis thaliana	sp\|Q9M811\|ROGFB_ARATH Rop guanine nucleotide exchange factor 11	69.100%	Swiss-Prot	High
`Q9SVQ3`	Arabidopsis thaliana	sp\|Q9SVQ3\|ROGF9_ARATH Rop guanine nucleotide exchange factor 9	69.900%	Swiss-Prot	High
`F4J1G1`	Arabidopsis thaliana	sp\|F4J1G1\|ROGFD_ARATH Rop guanine nucleotide exchange factor 13	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card