TkA05G000800 | RubberDandelionOmics

Gene overview

TkA05G000800

Reference: TK1151 Chr: Chr05 Coordinates: 237547-238911 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

902 bp · TkA05G000800|TK1151|cDNA

TGTCCAAATGGAATTTATATAGATGCCCATATACTTTTAGGTGGAGCTGCGCCGCTTCACGACGGACACACGTGACGGAGACTGAACTACTCGGAGAAACATGGAGAAAGGTGATGCAAATGGGTCCTCGGCGGCGAAGAAGAGCCCGAAATCCTCGGCTAAGAAATCACGTGGCCCACCTCAGAGCTCCGTGGACACATTTGCTGTGCAATGCAACGACTGTTTCAAATGGAGGACATTGACAACAGAAGACGAGTTTG...

CDS

Download CDS FASTA

555 bp · TkA05G000800|TK1151|CDS

ATGGAGAAAGGTGATGCAAATGGGTCCTCGGCGGCGAAGAAGAGCCCGAAATCCTCGGCTAAGAAATCACGTGGCCCACCTCAGAGCTCCGTGGACACATTTGCTGTGCAATGCAACGACTGTTTCAAATGGAGGACATTGACAACAGAAGACGAGTTTGAAGAGTACAGAAGCAAGCAAAGTGAAGACCCATTCGTATGCACAAAACTCGAAGGAATCGTGTGTGATAACCCAGCTGACATTGAATACGATTCCTCAAG...

Protein

Download Protein FASTA

184 aa · TkA05G000800|TK1151|PROTEIN

MEKGDANGSSAAKKSPKSSAKKSRGPPQSSVDTFAVQCNDCFKWRTLTTEDEFEEYRSKQSEDPFVCTKLEGIVCDNPADIEYDSSRTWVMDKPNIPKTPKGFQRIIVLRRDYSKMDVQYVTPDGTRIRAAPGIITYLKEHPEYTNVSPGDFCFTSPKVMSDTIPEHIEKKSPGNSNKKVKKSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G000800`
TK1151 ID	TkA05G000800
OH-1004 ID	LXL04_003066
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.600
Protein coverage (%)	TK1151 72.283 / OH-1004 50.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G000800

Location Chr05:237547-238911 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63030`	Transcriptional regulator that binds CpG, CpNpN and CpNpG (N is A, T, or C) islands in promoters regardless the DNA methylation status.	No verified direct reference in this release
`At4g22745`	Probable transcriptional regulator.	No verified direct reference in this release
`At4g00416`	Probable transcriptional regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003066 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016581 NuRD complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0008327 methyl-CpG binding Molecular Function

GO:0019899 enzyme binding Molecular Function

KEGG gene cross-reference

ath:AT3G63030

ath:AT4G00416

ath:AT4G22745

ath:AT5G35330

ath:AT5G35338

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · TkA05G000800 · TK1151

Cytoplasm0.091

Rank 2 · TkA05G000800 · TK1151

Cell membrane0.017

Rank 3 · TkA05G000800 · TK1151

Mitochondrion0.011

Rank 4 · TkA05G000800 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA05G000800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07496zf-CW35-80 aa

PF01429MBD95-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G000800	`PF07496`	zf-CW	35	80	6.6e-09	36.4
TkA05G000800	`PF01429`	MBD	95	160	9.1e-15	54.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYB9`	Arabidopsis thaliana	sp\|Q9LYB9\|MBD4_ARATH Methyl-CpG-binding domain-containing protein 4	55.600%	Swiss-Prot	High
`Q5XEN5`	Arabidopsis thaliana	sp\|Q5XEN5\|MBD1_ARATH Methyl-CpG-binding domain-containing protein 1	49.000%	Swiss-Prot	Medium
`Q4PSK1`	Arabidopsis thaliana	sp\|Q4PSK1\|MBD3_ARATH Methyl-CpG-binding domain-containing protein 3	31.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card