TkA04G517460 | RubberDandelionOmics

Gene overview

TkA04G517460

Reference: TK1151 Chr: Chr04 Coordinates: 130761554-130769559 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5099 bp · TkA04G517460|TK1151|cDNA

CCGCCTTCTTTTGCTTGGTCTACGACTCCCTTTCTTGTCCGCTCTTCTTTCTTATCCATTTTTCTACGTTTCTTATTTAGGATGTATGGTATCTCTGTTCTATTCAAATTTCTATTCAAAGGCTCCACACGTGTCTCCCGGTTGCAGTTCTCTATCTCTTTCATCTAATTCTCGAATTTTCCTCTGCGCTTAGCGTTCCTTCGCTTCTCTTCAGTTGTTGTTTCCTTCGGTTCTCATCAACAAACTCCCGTCAGTCCCCG...

CDS

Download CDS FASTA

543 bp · TkA04G517460|TK1151|CDS

ATGATTTCAGCAAAAGTGTATTCAATGATCGGATTGTTACATTTTGTGATCAGTGTGAAAGAGAGTATCATATCGTGTGTCTTAAGGGAACACAAAATGGCCGACTTAGAGGCATTGCCAAAAGATTTGCTGATTCGCGAACAAGAGATTGTTCATGAAGAGTTGTTGACTTTTGTGAGGAAGAAGGAGAAGGAGAAAAAGGAAACGGAGAAAGAAAATGAAAATGAAAAGAAAAGTGAAGAGGAGAAGGAAAATGAAAA...

Protein

Download Protein FASTA

180 aa · TkA04G517460|TK1151|PROTEIN

MISAKVYSMIGLLHFVISVKESIISCVLREHKMADLEALPKDLLIREQEIVHEELLTFVRKKEKEKKETEKENENEKKSEEEKENENEKEQEKENENEEGQESKCSSEMKFVLLCGKNATWESKPFLTQTIDIFHVSSILLHPTLPYYITSARDFIPSMVYGRKIWSQNFAGMVKCSKCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G517460`
TK1151 ID	TkA04G517460
OH-1004 ID	LXL04_032602
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.200
Protein coverage (%)	TK1151 86.111 / OH-1004 17.575 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G517460`
Location	Chr04:130761554-130769559 (-)
Description	Similar to IDM1: Increased DNA methylation 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032602` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0015671 oxygen transport Biological Process GO:0035092 sperm DNA condensation Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0045595 regulation of cell differentiation Biological Process
KEGG gene cross-reference	ath:AT3G14980 hsa:1108 mmu:107932 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.420

Rank 1 · TkA04G517460 · TK1151

Cytoplasm0.418

Rank 2 · TkA04G517460 · TK1151

Mitochondrion0.147

Rank 3 · TkA04G517460 · TK1151

Cell membrane0.101

Rank 4 · TkA04G517460 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA04G517460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19268CIS_TMP19-149 aa

PF10221Mat89Bb21-118 aa

PF03522SLC1226-105 aa

PF08704GCD1428-93 aa

PF15501MDM130-107 aa

PF22770POP1_C35-103 aa

PF02932Neur_chan_memb37-104 aa

PF13892DBINO38-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G517460	`PF19268`	CIS_TMP	19	149	0.0035	17.4
TkA04G517460	`PF10221`	Mat89Bb	21	118	0.0082	15.6
TkA04G517460	`PF03522`	SLC12	26	105	0.089	12.5
TkA04G517460	`PF08704`	GCD14	28	93	2.5	8.4
TkA04G517460	`PF15501`	MDM1	30	107	0.034	13.8
TkA04G517460	`PF22770`	POP1_C	35	103	2.9	8.8
TkA04G517460	`PF02932`	Neur_chan_memb	37	104	0.3	12.0
TkA04G517460	`PF13892`	DBINO	38	93	0.028	15.5
TkA04G517460	`PF17842`	dsRBD2	39	112	0.39	11.5
TkA04G517460	`PF24770`	Ig-CFAP74_2	40	133	0.035	15.3
TkA04G517460	`PF00350`	Dynamin_N	41	118	0.014	16.2
TkA04G517460	`PF15243`	ANAPC15	42	102	3.7	8.7
TkA04G517460	`PF24181`	TPR_TTI1_C	45	109	0.031	14.6
TkA04G517460	`PF04931`	DNA_pol_phi	46	101	0.38	9.6
TkA04G517460	`PF17110`	TFB6	46	102	4.1	7.9
TkA04G517460	`PF03286`	Pox_Ag35	47	105	0.029	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card