TkA04G512330 | RubberDandelionOmics

Gene overview

TkA04G512330

Reference: TK1151 Chr: Chr04 Coordinates: 129413470-129418155 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1650 bp · TkA04G512330|TK1151|cDNA

CCCCAACACACAACACCACACAAAGACATGGCCTCAACTCTCGAAATCAACGACTTCGCTCACAAGGACCTCGACGACGATGGTCGTGAAAAGCGTACAGGGACGTGGGTGACCGCAAGTGCACACATTATAACCGCGGTGATTGGGTCCGGTGTGTTGTCTCTGGCATGGGCCATTGCTCAATTGGGTTGGATCGCGGGTCCCTCCATTCTCATGATCTTTTCTTTCATCACTTACTTCACCTCCACCCTCCTCGCGGA...

CDS

Download CDS FASTA

1407 bp · TkA04G512330|TK1151|CDS

ATGGCCTCAACTCTCGAAATCAACGACTTCGCTCACAAGGACCTCGACGACGATGGTCGTGAAAAGCGTACAGGGACGTGGGTGACCGCAAGTGCACACATTATAACCGCGGTGATTGGGTCCGGTGTGTTGTCTCTGGCATGGGCCATTGCTCAATTGGGTTGGATCGCGGGTCCCTCCATTCTCATGATCTTTTCTTTCATCACTTACTTCACCTCCACCCTCCTCGCGGATTCGTACCGTGCACCGGACCCTGTGTC...

Protein

Download Protein FASTA

468 aa · TkA04G512330|TK1151|PROTEIN

MASTLEINDFAHKDLDDDGREKRTGTWVTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSILMIFSFITYFTSTLLADSYRAPDPVSGKRNYTYMDVVRAGLGGNKVQLCGIAQYVNLVGITIGYTITSSISIVAIKKANCFHYRGHDAPCNPSNYPYMIGFAVVQIVLCQIPNFHKLSWLSMLAAIMSFAYSFIGLGLSIAKAINSDAKTSLTGAQVGPNLSSMDKMWRTLQAIGDMAFSYAFSTVLIEIQDTLKSYPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G512330`
TK1151 ID	TkA04G512330
OH-1004 ID	LXL04_030258
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.200
Protein coverage (%)	TK1151 99.359 / OH-1004 96.687 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G512330

Location Chr04:129413470-129418155 (-)

Description Similar to AAP6: Amino acid permease 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49630`	Amino acid-proton symporter.	No verified direct reference in this release
`At1g58360`	Amino acid-proton symporter.	AAP1 transports uncharged amino acids into roots of Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03045.x AAP1 regulates import of amino acids into developing Arabidopsis embryos.2009 · DOI: 10.1111/j.1365-313x.2009.03890.x Substrate specificity and expression profile of amino acid transporters (AAPs) in Arabidopsis.1995 · DOI: 10.1074/jbc.270.27.16315 Differential expression of two related amino acid transporters with differing substrate specificity in Arabidopsis thaliana.1993 · DOI: 10.1046/j.1365-313x.1993.04060993.x
`At1g10010`	Amino acid-proton symporter.	The amino acid permease AAP8 is important for early seed development in Arabidopsis thaliana.2007 · DOI: 10.1007/s00425-007-0527-x
`At1g77380`	Amino acid-proton symporter.	Substrate specificity and expression profile of amino acid transporters (AAPs) in Arabidopsis.1995 · DOI: 10.1074/jbc.270.27.16315
`At5g63850`	Amino acid-proton symporter.	Substrate specificity and expression profile of amino acid transporters (AAPs) in Arabidopsis.1995 · DOI: 10.1074/jbc.270.27.16315

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030258 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006865 amino acid transport Biological Process

GO:0006952 defense response Biological Process

GO:0009624 response to nematode Biological Process

GO:0015800 acidic amino acid transport Biological Process

GO:0015802 basic amino acid transport Biological Process

GO:0015804 neutral amino acid transport Biological Process

GO:0015808 L-alanine transport Biological Process

GO:0015810 aspartate transmembrane transport Biological Process

GO:0015827 tryptophan transport Biological Process

GO:0043090 amino acid import Biological Process

GO:0098712 L-glutamate import across plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G10010

ath:AT1G58360

ath:AT1G77380

ath:AT5G49630

ath:AT5G63850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.706

Rank 1 · TkA04G512330 · TK1151

Lysosome / Vacuole0.120

Rank 2 · TkA04G512330 · TK1151

Endoplasmic reticulum0.096

Rank 3 · TkA04G512330 · TK1151

Cytoplasm0.093

Rank 4 · TkA04G512330 · TK1151

Golgi apparatus0.049

Rank 5 · TkA04G512330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans23-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G512330	`PF01490`	Aa_trans	23	456	2.5e-120	402.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92934`	Arabidopsis thaliana	sp\|P92934\|AAP6_ARATH Amino acid permease 6	69.000%	Swiss-Prot	High
`Q42400`	Arabidopsis thaliana	sp\|Q42400\|AAP1_ARATH Amino acid permease 1	67.000%	Swiss-Prot	High
`O80592`	Arabidopsis thaliana	sp\|O80592\|AAP8_ARATH Amino acid permease 8	63.700%	Swiss-Prot	High
`Q39134`	Arabidopsis thaliana	sp\|Q39134\|AAP3_ARATH Amino acid permease 3	58.600%	Swiss-Prot	High
`Q9FN04`	Arabidopsis thaliana	sp\|Q9FN04\|AAP4_ARATH Amino acid permease 4	56.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card