TkA04G511740 | RubberDandelionOmics

Gene overview

TkA04G511740

Reference: TK1151 Chr: Chr04 Coordinates: 129241572-129244276 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1763 bp · TkA04G511740|TK1151|cDNA

GACAATCTCATTTAATTTTATAGTTTTCAATTTTCATGTGTAGAAGAAATATAAAATTTGGAAGGTTTCTCATGAAAGCTTTAAAAGGCGAGTTTGAACCAGAAACTCTCATTGCTTAAGCTGCTCCCTCTTCATCCAACCCCCATCCTTTTTTCCATTATTATTCCTTCATAAACACCTAACAAACACACAAACACTCCCCATTAAGATGTCCGTCCTCCTAGCTTGCACATATTCCCCTAATCACTCCGTTGGCCCTT...

CDS

Download CDS FASTA

1218 bp · TkA04G511740|TK1151|CDS

ATGGATTTTGGGGTTTTAGATGGGTTGGTTTCTTCAGACAACAAAAAAAACACTCTAAGTTCTTGTTGCGATTTGGATCTTAAACCCAAATGGTTCGGATCTGGAGGCGGGTTTTGTAAACAAGAAAACCCTTTTTCTACTCCTGCTACTGGTACTCGCGAAGATGAATGGAGAGACTTAAAAATGGCGAAGATTGGTGATGATGATATCTCAAGGAGATCTAATGCTGCCCAGAATATGCTGAGCTTTTCTTCACCAAA...

Protein

Download Protein FASTA

405 aa · TkA04G511740|TK1151|PROTEIN

MDFGVLDGLVSSDNKKNTLSSCCDLDLKPKWFGSGGGFCKQENPFSTPATGTREDEWRDLKMAKIGDDDISRRSNAAQNMLSFSSPNTQTATFPYYARHNTVAGYGAGAGGPFTPSQWMELEHQALIYKYITANAAIPSNLLIPIKKALESAAFSAYSGAHLRHTSLGWGALHLGFCNSSDPEPGRCRRTDGKKWRCAKDAVVDQKYCERHMNRGRHRSRKPVEGQTCKSTTSNRHTTTTSQPATPTPAAPSSPDNMSMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G511740`
TK1151 ID	TkA04G511740
OH-1004 ID	LXL04_039174
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G511740

Location Chr04:129241572-129244276 (+)

Description Similar to GRF2: Growth-regulating factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37740`	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues.	No verified direct reference in this release
`At2g22840`	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0484900`	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.	No verified direct reference in this release
`Os03g0729500`	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.	No verified direct reference in this release
`Os03g0674700`	Transcription activator that plays a regulatory role in gibberellin-induced stem elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039174 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009409 response to cold Biological Process

GO:0009624 response to nematode Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0032502 developmental process Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G22840

ath:AT4G37740

dosa:Os03g0729500

dosa:Os11g0551900

dosa:Os12g0484900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA04G511740 · TK1151

Cytoplasm0.086

Rank 2 · TkA04G511740 · TK1151

Cell membrane0.026

Rank 3 · TkA04G511740 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA04G511740 · TK1151

Plastid0.013

Rank 5 · TkA04G511740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08880QLQ112-145 aa

PF08879WRC182-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G511740	`PF08880`	QLQ	112	145	9.6e-15	54.7
TkA04G511740	`PF08879`	WRC	182	224	1.2e-20	73.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L8A8`	Arabidopsis thaliana	sp\|Q8L8A8\|GRF2_ARATH Growth-regulating factor 2	33.900%	Swiss-Prot	Medium
`O81001`	Arabidopsis thaliana	sp\|O81001\|GRF1_ARATH Growth-regulating factor 1	35.700%	Swiss-Prot	Medium
`Q6AWY2`	Oryza sativa subsp. japonica	sp\|Q6AWY2\|GRF7_ORYSJ Growth-regulating factor 7	38.300%	Swiss-Prot	Medium
`Q6AWY3`	Oryza sativa subsp. japonica	sp\|Q6AWY3\|GRF6_ORYSJ Growth-regulating factor 6	65.400%	Swiss-Prot	Low
`Q9FRG8`	Oryza sativa subsp. japonica	sp\|Q9FRG8\|GRF9_ORYSJ Growth-regulating factor 9	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card