TkA04G506340 | RubberDandelionOmics

Gene overview

TkA04G506340

Reference: TK1151 Chr: Chr04 Coordinates: 127919546-127920043 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · TkA04G506340|TK1151|cDNA

ATGAAGAACCAAGCAATCCGCTTTGGTGGACAGACAGTGGACGGATGTCGTCAGTTTTTGCCGGCTGGTGGTGAAGGAACCATGGAGGCACTGAAATGCAAGGTTTGTAACTGTCATCGGAACTTCCACCGAAAGGTACTCGAGGTGCAAGTGCAACAACCCCAAGAAACGTTTCACCACCATACGCCGCCCCCATGTGTTTGCTCCAGCGGAGGTGGTTCTAAAAAGCGTTTTCGAACAAAATTTACTCACTATCAGAA...

CDS

Download CDS FASTA

417 bp · TkA04G506340|TK1151|CDS

ATGAAGAACCAAGCAATCCGCTTTGGTGGACAGACAGTGGACGGATGTCGTCAGTTTTTGCCGGCTGGTGGTGAAGGAACCATGGAGGCACTGAAATGCAAGGTTTGTAACTGTCATCGGAACTTCCACCGAAAGGTACTCGAGGTGCAAGTGCAACAACCCCAAGAAACGTTTCACCACCATACGCCGCCCCCATGTGTTTGCTCCAGCGGAGGTGGTTCTAAAAAGCGTTTTCGAACAAAATTTACTCACTATCAGAA...

Protein

Download Protein FASTA

138 aa · TkA04G506340|TK1151|PROTEIN

MKNQAIRFGGQTVDGCRQFLPAGGEGTMEALKCKVCNCHRNFHRKVLEVQVQQPQETFHHHTPPPCVCSSGGGSKKRFRTKFTHYQKDRMLVFSEALGWRIQKDNEAAVQQFCAEIGISRPVLKVWMHNNKHTLGKKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G506340`
TK1151 ID	TkA04G506340
OH-1004 ID	LXL04_030167
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	41.300
Protein coverage (%)	TK1151 97.101 / OH-1004 76.863 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G506340

Location Chr04:127919546-127920043 (+)

Description Similar to ZHD1: Zinc-finger homeodomain protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24660`	Essential protein.	No verified direct reference in this release
`At5g65410`	Putative transcription factor.	No verified direct reference in this release
`At2g02540`	Putative transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z259`	Putative transcription factor.	No verified direct reference in this release
`Os09g0466400`	Putative transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0050793 regulation of developmental process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT4G24660

dosa:Os08g0479400

dosa:Os09g0466400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · TkA04G506340 · TK1151

Cytoplasm0.150

Rank 2 · TkA04G506340 · TK1151

Mitochondrion0.025

Rank 3 · TkA04G506340 · TK1151

Cell membrane0.022

Rank 4 · TkA04G506340 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA04G506340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04770ZF-HD_dimer1-46 aa

PF24852DUF772625-43 aa

PF29390DUF853974-95 aa

PF24852DUF7726101-135 aa

PF29390DUF8539113-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G506340	`PF04770`	ZF-HD_dimer	1	46	2.5e-21	76.5
TkA04G506340	`PF24852`	DUF7726	25	43	0.16	12.8
TkA04G506340	`PF29390`	DUF8539	74	95	0.26	12.0
TkA04G506340	`PF24852`	DUF7726	101	135	0.16	12.8
TkA04G506340	`PF29390`	DUF8539	113	126	0.26	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB61`	Arabidopsis thaliana	sp\|Q9SB61\|ZHD2_ARATH Zinc-finger homeodomain protein 2	45.200%	Swiss-Prot	Medium
`Q9FKP8`	Arabidopsis thaliana	sp\|Q9FKP8\|ZHD1_ARATH Zinc-finger homeodomain protein 1	40.900%	Swiss-Prot	Medium
`O64722`	Arabidopsis thaliana	sp\|O64722\|ZHD3_ARATH Zinc-finger homeodomain protein 3	39.200%	Swiss-Prot	Medium
`A2Z259`	Oryza sativa subsp. indica	sp\|A2Z259\|ZHD1_ORYSI Zinc-finger homeodomain protein 1	37.800%	Swiss-Prot	Medium
`Q6YXH5`	Oryza sativa subsp. japonica	sp\|Q6YXH5\|ZHD1_ORYSJ Zinc-finger homeodomain protein 1	37.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card