TkA04G504060 | RubberDandelionOmics

Gene overview

TkA04G504060

Reference: TK1151 Chr: Chr04 Coordinates: 127312970-127316951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3007 bp · TkA04G504060|TK1151|cDNA

TTTTGAATGATAATAACGTTTTACTATTTTTTTTTATCAATCATTGATTTTCATCTTTAGTGATAATAACATTTTACTATTTTGATCAATGATTGATTTTTATCTTTAGGATAAAATATTAGGAGCATATTAAATAGGGGTAGGAATCCGATATGGATTACAATAGTAGTCCTTCATCTCCTTTATCTTTATGTTGCTTTTGCTTTGTTTGAATAGCAGGTAGAGAGGGAAATGGCCCTATTTATCGGGCAGCTGTTCCG...

CDS

Download CDS FASTA

1824 bp · TkA04G504060|TK1151|CDS

ATGATAGATGAAAATTCGAAAAAGAACAAGTTCTCTTGGTCAAAGTCGTTGGTTAGAAAGTGGTTCAGTATCAAGAGCAAATGCGAGGAATTTCAGACCAATAAAGGTGTTTATGGAGGTGGCGGTGGCGATGGCGAATGGAGGAATACTTTTTCTCAAAGGGAGCCACCTGCCATCAAGAAGACTAAAACAGAGAAGTCGAGCAAGAGTAGTACCGAGCGTCCCAGGCGAAGTAGAGTTTATCTCGATCACCCTCAGAT...

Protein

Download Protein FASTA

607 aa · TkA04G504060|TK1151|PROTEIN

MIDENSKKNKFSWSKSLVRKWFSIKSKCEEFQTNKGVYGGGGGDGEWRNTFSQREPPAIKKTKTEKSSKSSTERPRRSRVYLDHPQIINVHNYSIFAATWNVGGKSPSSNMNLDDWLHAAPPADIYVLGFQEVVPLNAVNILGSEDNGPAKKWLTLIRKTLNNRPGTSGGSGCYTPSPIPDPIAEYDADFEGSSRQKTSSLFHRKSFQAPRSWRTENDSSIPQSRLDRRYSVCDRAIFGHRPSDYSSSHRPSDYSSSGHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G504060`
TK1151 ID	TkA04G504060
OH-1004 ID	LXL04_039093
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G504060

Location Chr04:127312970-127316951 (+)

Description Similar to IP5P6: Type IV inositol polyphosphate 5-phosphatase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05470`	May have phosphatase activity toward PtdIns(4,5)P₂ and PtdIns(3,4,5)P₃.	Genetic regulation of vascular tissue patterning in Arabidopsis.1999 · DOI: 10.1105/tpc.11.11.2123 Cotyledon vascular pattern2-mediated inositol (1,4,5) triphosphate signal transduction is essential for closed venation patterns of Arabidopsis foliar organs.2004 · DOI: 10.1105/tpc.021030 CVP2- and CVL1-mediated phosphoinositide signaling as a regulator of the ARF GAP SFC/VAN3 in establishment of foliar vein patterns.2009 · DOI: 10.1111/j.1365-313x.2009.03920.x Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.2015 · DOI: 10.1242/dev.118364
`At2g32010`	Has phosphatase activity toward PtdIns(4,5)P₂ and, more weakly, PtdIns(3,4,5)P₃, but not Ins(1,4,5)P₃.	CVP2- and CVL1-mediated phosphoinositide signaling as a regulator of the ARF GAP SFC/VAN3 in establishment of foliar vein patterns.2009 · DOI: 10.1111/j.1365-313x.2009.03920.x Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.2015 · DOI: 10.1242/dev.118364
`At3g63240`	Type I inositol polyphosphate 5-phosphatase 4.	No verified direct reference in this release
`At2g37440`	Type I inositol polyphosphate 5-phosphatase 8.	No verified direct reference in this release
`At5g65090`	May be involved in the regulation of root hairs development.	Genetic interactions during root hair morphogenesis in Arabidopsis.2000 · DOI: 10.1105/tpc.12.10.1961 Analysis of the root-hair morphogenesis transcriptome reveals the molecular identity of six genes with roles in root-hair development in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02609.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039093 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0032957 inositol trisphosphate metabolic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0048765 root hair cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G05470

ath:AT2G32010

ath:AT3G63240

ath:AT5G65090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.380

Rank 1 · TkA04G504060 · TK1151

Nucleus0.306

Rank 2 · TkA04G504060 · TK1151

Cell membrane0.287

Rank 3 · TkA04G504060 · TK1151

Plastid0.071

Rank 4 · TkA04G504060 · TK1151

Golgi apparatus0.071

Rank 5 · TkA04G504060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22669Exo_endo_phos299-164 aa

PF22669Exo_endo_phos2333-565 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G504060	`PF22669`	Exo_endo_phos2	99	164	5.2e-73	246.8
TkA04G504060	`PF22669`	Exo_endo_phos2	333	565	5.2e-73	246.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LR47`	Arabidopsis thaliana	sp\|Q9LR47\|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6	68.200%	Swiss-Prot	High
`Q0WQ41`	Arabidopsis thaliana	sp\|Q0WQ41\|IP5P7_ARATH Type IV inositol polyphosphate 5-phosphatase 7	67.900%	Swiss-Prot	High
`Q8GTS0`	Arabidopsis thaliana	sp\|Q8GTS0\|IP5P4_ARATH Type I inositol polyphosphate 5-phosphatase 4	55.900%	Swiss-Prot	High
`Q0WT19`	Arabidopsis thaliana	sp\|Q0WT19\|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8	40.100%	Swiss-Prot	Medium
`Q66GQ6`	Arabidopsis thaliana	sp\|Q66GQ6\|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5	38.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card