TkA04G501870 | RubberDandelionOmics

Gene overview

TkA04G501870

Reference: TK1151 Chr: Chr04 Coordinates: 126717766-126728122 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1968 bp · TkA04G501870|TK1151|cDNA

GGATAATCGTTTCTATGAAACCCTCTATATCTTTTTGTGAACGGAGTATTATTTGCAAGAGCAAAGGTTACTCCGATCGACATAACCTACTGTTGCGTGCCTACTTCTCCCCCTCTGCCGCTGCCTGCTCCGGACTGGCTGACTGACTCAGTAGCTCAGCAACTCCGGCATCCGCCGACGCATACTACTTCTTCCTACATCCGACTGCTGAGTGTTCCTTTTCGTCTAATTGAAATATTCGACAACTATGACTGAACAAG...

CDS

Download CDS FASTA

1920 bp · TkA04G501870|TK1151|CDS

ATGACTGAACAAGAAGCTCTGATCGATGAAAACTTCCCTTTATTTTCTCAAAAACCAAAAACCAAATCCTCCAAACCTGTCACCACCCCTACCCCTACCCCTACCCCTACCCCTACCCACGACCAATTAGTGAAAGACACGTCATCCACCACCCATCTCAGTTTCACTGACCTAAATCTTTCAGATTGGGCTCTTCAAACCTGCAAAGAACTGGGCATGAAGAAACCCACCCCTGTTCAACAACACTGCATCCCCCGTAT...

Protein

Download Protein FASTA

639 aa · TkA04G501870|TK1151|PROTEIN

MTEQEALIDENFPLFSQKPKTKSSKPVTTPTPTPTPTPTHDQLVKDTSSTTHLSFTDLNLSDWALQTCKELGMKKPTPVQQHCIPRILSGEDVLGIAQTGSGKTAAFALSILHRLAEDPYGVFCLVVTPTRELAYQLAEQFRALGSCLNLRCAVIVGGMDMITQSHTLMQRPHVVIATPGRIKVLIEQNPDIPPVFSNTKFLVLDEADRVLDTGFEDELRVVFNCLPKKRQTLLFSATMTSNLQSLLEVSANKAYFYEAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G501870`
TK1151 ID	TkA04G501870
OH-1004 ID	LXL04_039073
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.200
Protein coverage (%)	TK1151 78.247 / OH-1004 99.799 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G501870

Location Chr04:126717766-126728122 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16280`	DEAD-box ATP-dependent RNA helicase 36.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0633500`	DEAD-box ATP-dependent RNA helicase 36.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039073 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0044357 regulation of rRNA stability Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G16280

ddi:DDB_G0270396

dosa:Os07g0633500

hsa:54555

mmu:234374

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.456

Rank 1 · TkA04G501870 · TK1151

Cytoplasm0.372

Rank 2 · TkA04G501870 · TK1151

Mitochondrion0.107

Rank 3 · TkA04G501870 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA04G501870 · TK1151

Cell membrane0.060

Rank 5 · TkA04G501870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04851ResIII75-239 aa

PF00270DEAD77-245 aa

PF13401AAA_2296-238 aa

PF00271Helicase_C124-168 aa

PF00271Helicase_C228-244 aa

PF00271Helicase_C293-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G501870	`PF04851`	ResIII	75	239	1.4e-07	32.2
TkA04G501870	`PF00270`	DEAD	77	245	1.3e-46	159.1
TkA04G501870	`PF13401`	AAA_22	96	238	0.04	14.9
TkA04G501870	`PF00271`	Helicase_C	124	168	1.3e-27	96.9
TkA04G501870	`PF00271`	Helicase_C	228	244	1.3e-27	96.9
TkA04G501870	`PF00271`	Helicase_C	293	392	1.3e-27	96.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA27`	Arabidopsis thaliana	sp\|Q9SA27\|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36	72.300%	Swiss-Prot	High
`Q8L4E9`	Oryza sativa subsp. japonica	sp\|Q8L4E9\|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36	64.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card