TkA04G500930 | RubberDandelionOmics

Gene overview

TkA04G500930

Reference: TK1151 Chr: Chr04 Coordinates: 126476441-126485075 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1854 bp · TkA04G500930|TK1151|cDNA

CGTGCTTCCATCAAACTCCCATCCAACATCCATATTTATACACACGTACCAGAATACACCAACAGACGGAAAATTTATCAAAATATTATTATAGCATGGCTTCAAGGCCATTCATTTCAAAGCAAAAACCTCTCCCGCTCTTCTTCTTCTCCTCCTTTGTCTCGCCATCACGCTTCTAATCCACACCACCACCACCAGCCTCCGCCTTGACCACCATGTTCAACCAGTAACAACCGCCCTCAACCTTCTAGCCACAGAAG...

CDS

Download CDS FASTA

1035 bp · TkA04G500930|TK1151|CDS

ATGTGGGAGATATTTAGGTGTGATGATATGATATTGAAAGAAGACGATTATAGGATATACAAACCAGATTTAAAAAGACTCCGGCAAATGGTGAATATGCCCGTCGGCTCTTGCAACATTCCATCTCTACAACCTCCTGGTCAATTGCCGTCCAACACATACAATTCAAGAGAGGCATATGTAACTGTCCTCCATTCCTCCGAAACATATGTTTGTGGAGCAATAGCATTGGCACAAAGCATCCTACAAACCAACTCTAC...

Protein

Download Protein FASTA

344 aa · TkA04G500930|TK1151|PROTEIN

MWEIFRCDDMILKEDDYRIYKPDLKRLRQMVNMPVGSCNIPSLQPPGQLPSNTYNSREAYVTVLHSSETYVCGAIALAQSILQTNSTKDLLLLADDSISPKSLRGLKAAGWKIKHIERIRSPRAKKAAYNEYNYSKLRIWQLIEYDKVIFIDADLIVLKNLDEFFNYPQLSAVGNDKYIFNSGVIVVEPSECMFNGLMEKRFTFESYNGGDQGFLNEAFTWWHRFHSKVNHLKVFEGTNNPRREIPENVHTVHYLGLKPW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G500930`
TK1151 ID	TkA04G500930
OH-1004 ID	LXL04_039068
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 64.540 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G500930

Location Chr04:126476441-126485075 (+)

Description Similar to GUX4: Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54940`	May be involved in the substitutions of the xylan backbone in stem glucuronoxylan.	No verified direct reference in this release
`At1g08990`	May be involved in the substitutions of the xylan backbone in stem glucuronoxylan.	No verified direct reference in this release
`UniProt: Q8GWW4`	Glycosyltransferase required for the addition of both glucuronic acid and 4-O-methylglucuronic acid branches to xylan in stem cell walls.	No verified direct reference in this release
`At3g18660`	Glycosyltransferase required for the addition of both glucuronic acid and 4-O-methylglucuronic acid branches to xylan in stem cell walls.	Absence of branches from xylan in Arabidopsis gux mutants reveals potential for simplification of lignocellulosic biomass.2010 · DOI: 10.1073/pnas.1005456107 An integrative approach to the identification of Arabidopsis and rice genes involved in xylan and secondary wall development.2010 · DOI: 10.1371/journal.pone.0015481
`At1g77130`	May be involved in the substitutions of the xylan backbone in stem glucuronoxylan.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039068 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08990

ath:AT1G54940

ath:AT1G77130

ath:AT3G18660

ath:AT4G33330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.705

Rank 1 · TkA04G500930 · TK1151

Endoplasmic reticulum0.119

Rank 2 · TkA04G500930 · TK1151

Extracellular0.087

Rank 3 · TkA04G500930 · TK1151

Cytoplasm0.083

Rank 4 · TkA04G500930 · TK1151

Cell membrane0.065

Rank 5 · TkA04G500930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28720GUX1-5_N1-38 aa

PF19518RHG35-p190PhoGP_pG116-110 aa

PF01501Glyco_transf_863-260 aa

PF11051Mannosyl_trans3145-168 aa

PF11141DUF2914311-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G500930	`PF28720`	GUX1-5_N	1	38	2.4e-09	37.7
TkA04G500930	`PF19518`	RHG35-p190PhoGP_pG1	16	110	0.091	12.7
TkA04G500930	`PF01501`	Glyco_transf_8	63	260	7e-20	72.4
TkA04G500930	`PF11051`	Mannosyl_trans3	145	168	0.012	15.8
TkA04G500930	`PF11141`	DUF2914	311	337	0.078	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ37`	Arabidopsis thaliana	sp\|Q9FZ37\|GUX4_ARATH Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4	56.800%	Swiss-Prot	High
`F4HZC3`	Arabidopsis thaliana	sp\|F4HZC3\|GUX5_ARATH Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5	55.600%	Swiss-Prot	High
`Q8GWW4`	Arabidopsis thaliana	sp\|Q8GWW4\|GUX2_ARATH UDP-glucuronate:xylan alpha-glucuronosyltransferase 2	54.000%	Swiss-Prot	High
`Q9LSB1`	Arabidopsis thaliana	sp\|Q9LSB1\|GUX1_ARATH UDP-glucuronate:xylan alpha-glucuronosyltransferase 1	49.300%	Swiss-Prot	Medium
`Q8W4A7`	Arabidopsis thaliana	sp\|Q8W4A7\|GUX3_ARATH Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card