TkA04G497460 | RubberDandelionOmics

Gene overview

TkA04G497460

Reference: TK1151 Chr: Chr04 Coordinates: 125622295-125626044 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

800 bp · TkA04G497460|TK1151|cDNA

CTGGAGCTTACATGATCGTGTCCACACTCGGTTTCATACTTTCGGTCGCGTTGTTAGACATATTTTACATCAATCCTTACAACATATCGTATTGGTGGTACAAAGGCCTTTTATTCACACTATGCATGGCCGCCAGTATTATTCTCTTTGGAGGCTTTGTTATCATTTTATGGCATCTTTGGGATAAAAAACATTCGCTTCAAAATAACACCGAGGATGAAAAGACAATCGATGGGTTACAATATAACGAGTCTAATGTA...

CDS

Download CDS FASTA

2235 bp · TkA04G497460|TK1151|CDS

ATGGGAACCGAAGGGACTCCGCGTGATCCTCTTCTTGTTTCTAGCAAAGAAGATCAGAACGGATTCGCCTACATCAACAAAACATCTCCCTTACTAAAATCTACCAAATGGGTTCTAAAATCAGCAATGTGGTTAATCTTCATCGCCTGGGTTAGTTTCTTGTTCTTAGTTCCATCAGATTCGGTAAAGCAATTGTATACGAAATTGGTTCATGCTACTTCTGGAACTCTTTTTGGGAATACTGGAAGCATCTTTCTGAT...

Protein

Download Protein FASTA

744 aa · TkA04G497460|TK1151|PROTEIN

MGTEGTPRDPLLVSSKEDQNGFAYINKTSPLLKSTKWVLKSAMWLIFIAWVSFLFLVPSDSVKQLYTKLVHATSGTLFGNTGSIFLIYSGPVLIIAFLAIIYLGICGEDEIQEKKKKHASFRLWTFPIIIDGPFGVVTAAELIGIVLFAVYIIWAIIAYTFENISLLPLFGITDSGKRALFMLELTGLRLGFIGLICMAFLFLPVARGSILLRLIDIPFEHAARYHVWLGHLTMLLFTLHGLFFVIPWAIEGQLIEKLTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G497460`
TK1151 ID	TkA04G497460
OH-1004 ID	LXL04_039037
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G497460

Location Chr04:125622295-125626044 (-)

Description Similar to FRO7: Ferric reduction oxidase 7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49740`	Ferric chelate reductase involved in iron mobilization from the cytosol into the chloroplast.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 Chloroplast Fe(III) chelate reductase activity is essential for seedling viability under iron limiting conditions.2008 · DOI: 10.1073/pnas.0708367105
`At5g49730`	Ferric chelate reductase involved in iron uptake by shoot and leaf cells.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 Overexpression of AtFRO6 in transgenic tobacco enhances ferric chelate reductase activity in leaves and increases tolerance to iron-deficiency chlorosis.2011 · DOI: 10.1007/s11033-010-0472-9
`At1g01590`	Ferric chelate reductase involved in iron reduction in roots (By similarity).	No verified direct reference in this release
`At1g01580`	Flavocytochrome that transfers electrons across the plasma membrane to reduce ferric iron chelates to form soluble ferrous iron in the rhizosphere.	A ferric-chelate reductase for iron uptake from soils.1999 · DOI: 10.1038/17800 Overexpression of the FRO2 ferric chelate reductase confers tolerance to growth on low iron and uncovers posttranscriptional control.2003 · DOI: 10.1104/pp.103.025122 Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 The FRO2 ferric reductase is required for glycine betaine's effect on chilling tolerance in Arabidopsis roots.2008 · DOI: 10.1111/j.1399-3054.2008.01141.x
`At5g23980`	Ferric chelate reductase.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090431

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039037 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0033212 iron import into cell Biological Process

GO:0033214 siderophore-iron import into cell Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01580

ath:AT1G01590

ath:AT5G23980

ath:AT5G49730

ath:AT5G49740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.350

Rank 1 · TkA04G497460 · TK1151

Lysosome / Vacuole0.239

Rank 2 · TkA04G497460 · TK1151

Endoplasmic reticulum0.197

Rank 3 · TkA04G497460 · TK1151

Golgi apparatus0.130

Rank 4 · TkA04G497460 · TK1151

Cytoplasm0.103

Rank 5 · TkA04G497460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01736Polyoma_agno95-118 aa

PF08022FAD_binding_8116-136 aa

PF01794Ferric_reduct126-156 aa

PF01794Ferric_reduct190-312 aa

PF01736Polyoma_agno324-347 aa

PF08022FAD_binding_8345-455 aa

PF08030NAD_binding_6462-544 aa

PF00175NAD_binding_1467-543 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G497460	`PF01736`	Polyoma_agno	95	118	0.038	14.6
TkA04G497460	`PF08022`	FAD_binding_8	116	136	1e-19	71.3
TkA04G497460	`PF01794`	Ferric_reduct	126	156	6e-23	81.9
TkA04G497460	`PF01794`	Ferric_reduct	190	312	6e-23	81.9
TkA04G497460	`PF01736`	Polyoma_agno	324	347	0.038	14.6
TkA04G497460	`PF08022`	FAD_binding_8	345	455	1e-19	71.3
TkA04G497460	`PF08030`	NAD_binding_6	462	544	4.6e-19	69.7
TkA04G497460	`PF00175`	NAD_binding_1	467	543	0.00032	22.0
TkA04G497460	`PF01794`	Ferric_reduct	609	629	6e-23	81.9
TkA04G497460	`PF08030`	NAD_binding_6	654	721	4.6e-19	69.7
TkA04G497460	`PF00175`	NAD_binding_1	704	717	0.00032	22.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3KTM0`	Arabidopsis thaliana	sp\|Q3KTM0\|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic	59.400%	Swiss-Prot	High
`Q8RWS6`	Arabidopsis thaliana	sp\|Q8RWS6\|FRO6_ARATH Ferric reduction oxidase 6	58.200%	Swiss-Prot	High
`Q9LMM2`	Arabidopsis thaliana	sp\|Q9LMM2\|FRO1_ARATH Probable ferric reduction oxidase 1	33.100%	Swiss-Prot	Medium
`P92949`	Arabidopsis thaliana	sp\|P92949\|FRO2_ARATH Ferric reduction oxidase 2	31.800%	Swiss-Prot	Medium
`Q8W110`	Arabidopsis thaliana	sp\|Q8W110\|FRO4_ARATH Ferric reduction oxidase 4	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card