RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G487180
Reference: TK1151 Chr: Chr04 Coordinates: 123106910-123108998 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1836 bp · TkA04G487180|TK1151|cDNA

AATTTATTTATTTTACCTACAATAACTTAATTTTCACATGTATTTTACTTCAATAAAGAAGCCGAATAAAAAACGAGCTCACCGCCTGTTTAGCCTTGCTTTCAATCAACTGATAACTCCAAAAGGAGGTGAAGTCTGCAATCTTCTCAGCTGCCATCGCTCATCGCCGTCGTTGTCATCCAAAATCTTCTTTTCATCGTCGATTCATCATCGCCGGATTCTCTTGATACATATGACGACAATCTCAACCCCTCCGTCCA...

CDS

Download CDS FASTA

1491 bp · TkA04G487180|TK1151|CDS

ATGTATTTTACTTCAATAAAGAAGCCGAATAAAAAACGAGCTCACCGCCTGTTTAGCCTTGCTTTCAATCAACTGATAACTCCAAAAGGAGGTGAAGTCTGCAATCTTCTCAGCTGCCATCGCTCATCGCCGTCGTTGTCATCCAAAATCTTCTTTTCATCGTCGATTCATCATCGCCGGATTCTCTTGATACATATGACGACAATCTCAACCCCTCCGTCCAATACCCTTGATTCCGTTTCTCCAGTAACGCTAACCAT...

Protein

Download Protein FASTA

496 aa · TkA04G487180|TK1151|PROTEIN

MYFTSIKKPNKKRAHRLFSLAFNQLITPKGGEVCNLLSCHRSSPSLSSKIFFSSSIHHRRILLIHMTTISTPPSNTLDSVSPVTLTMDQHTSPPSSSPPDQQQSVDYPTPPFDFTSSSTTSSLPPTSPDSHHSPAAIELPNLLHLSFNQDSGCFAAGTDRGFRIFNCDPFREIFRRDFDSGGGIGVVQMLFRCNILALVGGGPEPQYPLNKVMIWDDHQSRCIGELSFRSEVKSVRLRRDRIVVILLQKIYVYNFADLKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G487180
TK1151 IDTkA04G487180
OH-1004 IDLXL04_038935
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.800
Protein coverage (%)TK1151 95.968 / OH-1004 39.113
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G487180
LocationChr04:123106910-123108998 (-)
DescriptionSimilar to DEGP14: Putative protease Do-like 14
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g62770 May act as a PI(3,5)P₂ regulatory-complex component in phosphatidylinositol 3,5-bisphosphate synthesis and turnover.
Autophagy differentially controls plant basal immunity to biotrophic and necrotrophic pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04546.x
A critical role of autophagy in plant resistance to necrotrophic fungal pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04553.x
The autophagy gene, ATG18a, plays a negative role in powdery mildew resistance and mildew-induced cell death in Arabidopsis.2011 · DOI: 10.4161/psb.6.9.16967
At2g40810 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release
At3g56440 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release
At5g05150 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038935 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000422 autophagy of mitochondrion Biological Process
GO:0000425 pexophagy Biological Process
GO:0006508 proteolysis Biological Process
GO:0006914 autophagy Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010508 positive regulation of autophagy Biological Process
GO:0015031 protein transport Biological Process
GO:0034497 protein localization to phagophore assembly site Biological Process
KEGG gene cross-reference
ath:AT2G40810
ath:AT3G62770
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536
Rank 1 · TkA04G487180 · TK1151
Nucleus0.303
Rank 2 · TkA04G487180 · TK1151
Lysosome / Vacuole0.154
Rank 3 · TkA04G487180 · TK1151
Cell membrane0.125
Rank 4 · TkA04G487180 · TK1151
Golgi apparatus0.112
Rank 5 · TkA04G487180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23383Beta-prop_IFT140_1st142-161 aa
PF21032PROPPIN144-487 aa
PF25174Beta-prop_THOC3144-398 aa
PF00400WD40144-166 aa
PF23381Beta-prop_IFT122_1st144-161 aa
PF21034BCAS3_WD40206-269 aa
PF25175Beta-prop_WDR5210-243 aa
PF25173Beta-prop_WDR3_1st210-236 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G487180PF23383Beta-prop_IFT140_1st1421610.0313.7
TkA04G487180PF21032PROPPIN1444872.5e-30106.6
TkA04G487180PF25174Beta-prop_THOC31443982.9e-1556.7
TkA04G487180PF00400WD401441662e-1144.6
TkA04G487180PF23381Beta-prop_IFT122_1st1441613.7e-1143.6
TkA04G487180PF21034BCAS3_WD402062693e-1350.0
TkA04G487180PF25175Beta-prop_WDR52102432.7e-1040.7
TkA04G487180PF25173Beta-prop_WDR3_1st2102365.2e-0936.8
TkA04G487180PF25172Beta-prop_WDR3_2nd2102661.1e-0525.6
TkA04G487180PF24805EIF3I2103350.01814.9
TkA04G487180PF30361TRM82_WD2102470.1611.5
TkA04G487180PF23381Beta-prop_IFT122_1st2113353.7e-1143.6
TkA04G487180PF24817WD40_WDHD1_1st2113517.3e-1142.5
TkA04G487180PF24807WD40_CDC20-Fz2112358.5e-0935.8
TkA04G487180PF23414Beta-prop_EML_22112642e-0834.7
TkA04G487180PF30552CFAP251_N2112517.9e-0522.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93VB2Arabidopsis thalianasp|Q93VB2|AT18A_ARATH Autophagy-related protein 18a70.200%Swiss-ProtHigh
Q8GYD7Arabidopsis thalianasp|Q8GYD7|AT18C_ARATH Autophagy-related protein 18c57.300%Swiss-ProtHigh
Q0WPK3Arabidopsis thalianasp|Q0WPK3|AT18D_ARATH Autophagy-related protein 18d57.500%Swiss-ProtHigh
Q9FHK8Arabidopsis thalianasp|Q9FHK8|AT18E_ARATH Autophagy-related protein 18e43.500%Swiss-ProtMedium

JBrowse

View in Genome Browser