Gene Card
Gene overview
cDNA / CDS / Protein Sequences
306 bp · TkA04G478410|TK1151|cDNA
ATGCAATTCTGGATTGTGTTGACTGGTCTGTTGACTAACCAAAAGATTTGCAAAGGGTTTAAGAGCTGGAAGCAGTTGCGGATCATTCCTGTCAAAAGCTTCAGCAGTCAAGGGCAGTTTGGTCTTTTCAATTGGCAGCCTACTGCTAATCACAAGGACTATGATCATATTGCTGATGAGGTTCACGGGTCTAGACTGGGTGGAAAAAATCTCGAGCATCCATGGTTTCCGGGGACAGTTTTGGAAAGTTGTTGCAGTTT...
306 bp · TkA04G478410|TK1151|CDS
ATGCAATTCTGGATTGTGTTGACTGGTCTGTTGACTAACCAAAAGATTTGCAAAGGGTTTAAGAGCTGGAAGCAGTTGCGGATCATTCCTGTCAAAAGCTTCAGCAGTCAAGGGCAGTTTGGTCTTTTCAATTGGCAGCCTACTGCTAATCACAAGGACTATGATCATATTGCTGATGAGGTTCACGGGTCTAGACTGGGTGGAAAAAATCTCGAGCATCCATGGTTTCCGGGGACAGTTTTGGAAAGTTGTTGCAGTTT...
Protein
Download Protein FASTA101 aa · TkA04G478410|TK1151|PROTEIN
MQFWIVLTGLLTNQKICKGFKSWKQLRIIPVKSFSSQGQFGLFNWQPTANHKDYDHIADEVHGSRLGGKNLEHPWFPGTVLESCCSLGPEGRTAAVIIQEG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G478410 |
|---|---|
| TK1151 ID | TkA04G478410 |
| OH-1004 ID | LXL04_038934 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 77.800 |
| Protein coverage (%) | TK1151 99.010 / OH-1004 67.742Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G478410 |
|---|---|
| Location | Chr04:120876820-120877514 (+) |
| Description | Similar to PER48: Putative Peroxidase 48 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006950 response to stress Biological Process GO:0006979 response to oxidative stress Biological Process GO:0032922 circadian regulation of gene expression Biological Process GO:0042744 hydrogen peroxide catabolic process Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0080001 mucilage extrusion from seed coat Biological Process GO:0005576 extracellular region Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0004601 peroxidase activity Molecular Function GO:0020037 heme binding Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | ath:AT2G18140 ath:AT2G18150 ath:AT3G03670 ath:AT4G33870 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.