TkA04G472850 | RubberDandelionOmics

Gene overview

TkA04G472850

Reference: TK1151 Chr: Chr04 Coordinates: 119434735-119435829 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · TkA04G472850|TK1151|cDNA

ATGACGACAACCATCAGCGATATCCATCCCGACCTCATTCAGACCCACATCTTACCATTTCTCGACGGCCCATCCCTCTCCGCCACCGCAGCCGTCTCCTCACATCTACAAACCCTCTGCGCCGATGACATTCTCTGGTCCAATATGTGCAACTCCACTTGGCCCTCAGTTACCGACCCTCGTGTCGACGACATCATCTCCACCTTCCCCGCCGGTCACCGCTCCTTTTTCCACGACTCCTTTCCAGCTCTCGTCATCAC...

CDS

Download CDS FASTA

1095 bp · TkA04G472850|TK1151|CDS

ATGACGACAACCATCAGCGATATCCATCCCGACCTCATTCAGACCCACATCTTACCATTTCTCGACGGCCCATCCCTCTCCGCCACCGCAGCCGTCTCCTCACATCTACAAACCCTCTGCGCCGATGACATTCTCTGGTCCAATATGTGCAACTCCACTTGGCCCTCAGTTACCGACCCTCGTGTCGACGACATCATCTCCACCTTCCCCGCCGGTCACCGCTCCTTTTTCCACGACTCCTTTCCAGCTCTCGTCATCAC...

Protein

Download Protein FASTA

364 aa · TkA04G472850|TK1151|PROTEIN

MTTTISDIHPDLIQTHILPFLDGPSLSATAAVSSHLQTLCADDILWSNMCNSTWPSVTDPRVDDIISTFPAGHRSFFHDSFPALVITDATHHNRRRLDLPSHAWPSQIISAVNIRYQNDCIYSKLEFTDTTDAFLSSEFCISLDEEPESKPGTGIFQAIKLKVDELAGADEGRLSHLKESLALNWILIDPTRKRAGNISSVKPVGAWQGWMNDNIHVLYAVVLPGCDENNMVQYRIQVVLGTDEGTSGLHVKEVMLELLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G472850`
TK1151 ID	TkA04G472850
OH-1004 ID	LXL04_038876
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G472850

Location Chr04:119434735-119435829 (+)

Description Similar to At2g27310: F-box protein At2g27310

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27310`	F-box protein At2g27310.	No verified direct reference in this release
`At3g44326`	F-box protein At3g44326.	No verified direct reference in this release
`At2g36090`	Probable F-box protein At2g36090.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038876 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0019218 regulation of steroid metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT2G27310

ath:AT2G36090

ath:AT3G44326

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.573

Rank 1 · TkA04G472850 · TK1151

Cytoplasm0.343

Rank 2 · TkA04G472850 · TK1151

Endoplasmic reticulum0.127

Rank 3 · TkA04G472850 · TK1151

Cell membrane0.115

Rank 4 · TkA04G472850 · TK1151

Mitochondrion0.045

Rank 5 · TkA04G472850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like10-51 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G472850	`PF12937`	F-box-like	10	51	5.6e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIN8`	Arabidopsis thaliana	sp\|Q9XIN8\|FB119_ARATH F-box protein At2g27310	36.600%	Swiss-Prot	Medium
`Q2V3R1`	Arabidopsis thaliana	sp\|Q2V3R1\|FB346_ARATH F-box protein At3g44326	36.900%	Swiss-Prot	Medium
`Q9SIH5`	Arabidopsis thaliana	sp\|Q9SIH5\|FB322_ARATH Probable F-box protein At2g36090	34.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card