RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G470340
Reference: TK1151 Chr: Chr04 Coordinates: 118795759-118803682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5213 bp · TkA04G470340|TK1151|cDNA

AAAAACCACCTCCTACCAAAATCAATCTACAAAACCTCACTCACAGTCACTTGTACTGTTGTACACAATAAATAAAACACTCAACCGAAAGCCATCATAAATCGTGATACATCGAAGAATCCCTACAACAAGCAACCTTACACTTCAAAGGGGTATAACGTTCATCTATCCAAAAATCTTACCGGAAAATCAAACTCCGGATCTGTGTTCCTTTCTCGGTTTAGAAAATGGGAACGGCGAAGTTGTTAGATTCGGAAGAA...

CDS

Download CDS FASTA

4713 bp · TkA04G470340|TK1151|CDS

ATGGGAACGGCGAAGTTGTTAGATTCGGAAGAAGGTGGTGCGGTGAAACCAGCAGAAATGAAGAAAAAAAGAAAACAAGCCAAACCAACCACAGAGACATCTGATGTTACAATGGAAGATAAACCAAATGTCCCCACCAAAACCAAACCAAAAAGAGGAAGATCATCAAACACCACAGACCCCCCTCAAGTTTCCAGAAAGATGCCAAAACGAGCTGCTTCTTGCACCGACTTCAAAACCAAACCAGTCCGCCTTTCCGA...

Protein

Download Protein FASTA

1570 aa · TkA04G470340|TK1151|PROTEIN

MGTAKLLDSEEGGAVKPAEMKKKRKQAKPTTETSDVTMEDKPNVPTKTKPKRGRSSNTTDPPQVSRKMPKRAASCTDFKTKPVRLSEKSSTIENKKVKIVEEEIAALSIVPGPDDPRPNRRLTDFILHDENGNPQPVEMLEVNDLYISGQILPLEKTSEKEKEKEIGVRCEGFGRIEDWSISGYEDGSPVIWVSTELADYDCVKPSGTYRKLFGLFQEKANACIQVYKRLSKSSGGNPDLSLDELLASLVRSMSGSKNFP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G470340
TK1151 IDTkA04G470340
OH-1004 IDLXL04_038842
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G470340
LocationChr04:118795759-118803682 (+)
DescriptionSimilar to MET1B: DNA (cytosine-5)-methyltransferase 1B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g49160 Maintains chromatin CpG methylation that plays a role in genomic imprinting, regulation of embryogenesis and seed viability. No verified direct reference in this release
At4g14140 Maintains chromatin CpG methylation that plays a role in genomic imprinting, regulation of embryogenesis and seed viability. No verified direct reference in this release
At4g08990 Maintains chromatin CpG methylation that plays a role in genomic imprinting, regulation of embryogenesis and seed viability. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0182900 Major CG methylase that methylates chromatin CpG residues and maintains DNA methylation.
The MET1b gene encoding a maintenance DNA methyltransferase is indispensable for normal development in rice.2014 · DOI: 10.1007/s11103-014-0178-9
Mutation of a major CG methylase in rice causes genome-wide hypomethylation, dysregulated genome expression, and seedling lethality.2014 · DOI: 10.1073/pnas.1410761111
Os03g0798300 Probably methylates CpG residues and maintains DNA methylation.
Characterization of two rice DNA methyltransferase genes and RNAi-mediated reactivation of a silenced transgene in rice callus.2004 · DOI: 10.1007/s00425-003-1112-6
The MET1b gene encoding a maintenance DNA methyltransferase is indispensable for normal development in rice.2014 · DOI: 10.1007/s11103-014-0178-9
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038842 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process
GO:0009294 DNA-mediated transformation Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009910 negative regulation of flower development Biological Process
GO:0010069 zygote asymmetric cytokinesis in embryo sac Biological Process
GO:0010229 inflorescence development Biological Process
GO:0032259 methylation Biological Process
GO:0044027 negative regulation of gene expression via chromosomal CpG island methylation Biological Process
GO:0071514 genomic imprinting Biological Process
GO:0141044 epigenetic programming in the endosperm Biological Process
GO:0005634 nucleus Cellular Component
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT4G08990
ath:AT4G14140
ath:AT5G49160
dosa:Os03g0798300
dosa:Os07g0182900
osa:4334435
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930
Rank 1 · TkA04G470340 · TK1151
Cytoplasm0.108
Rank 2 · TkA04G470340 · TK1151
Cell membrane0.033
Rank 3 · TkA04G470340 · TK1151
Endoplasmic reticulum0.017
Rank 4 · TkA04G470340 · TK1151
Mitochondrion0.016
Rank 5 · TkA04G470340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12047DNMT1-RFD115-251 aa
PF17079SOTI249-266 aa
PF12047DNMT1-RFD420-571 aa
PF17079SOTI632-681 aa
PF01426BAH772-902 aa
PF17079SOTI775-808 aa
PF01426BAH944-1083 aa
PF00145DNA_methylase1131-1174 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G470340PF12047DNMT1-RFD1152511.4e-78262.6
TkA04G470340PF17079SOTI2492660.2212.7
TkA04G470340PF12047DNMT1-RFD4205711.4e-78262.6
TkA04G470340PF17079SOTI6326810.2212.7
TkA04G470340PF01426BAH7729025.4e-39133.6
TkA04G470340PF17079SOTI7758080.2212.7
TkA04G470340PF01426BAH94410835.4e-39133.6
TkA04G470340PF00145DNA_methylase113111745.1e-48164.9
TkA04G470340PF00145DNA_methylase121215595.1e-48164.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P34881Arabidopsis thalianasp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 158.300%Swiss-ProtHigh
O23273Arabidopsis thalianasp|O23273|DNMT4_ARATH DNA (cytosine-5)-methyltransferase 457.700%Swiss-ProtHigh
Q9M0S8Arabidopsis thalianasp|Q9M0S8|DNMT2_ARATH DNA (cytosine-5)-methyltransferase 256.800%Swiss-ProtHigh
B1Q3J6Oryza sativa subsp. japonicasp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B59.800%Swiss-ProtHigh
Q7Y1I7Oryza sativa subsp. japonicasp|Q7Y1I7|DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A58.400%Swiss-ProtHigh

JBrowse

View in Genome Browser