TkA04G464120 | RubberDandelionOmics

Gene overview

TkA04G464120

Reference: TK1151 Chr: Chr04 Coordinates: 117157281-117161035 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · TkA04G464120|TK1151|cDNA

CTGACACGTGGTGTAGGGTCCACCATCTCTATAAAGGAGAGTGAGCTTGAGATGAAGTCGTCGAAGAGATATCTTCTTCTTCATGGAGGCACGACCAGTTGCCTTTATTATCTCTGAATCATGTCTCCTTCATCTGCAAATCTGTACGTCGATCTGTCGAGTTCTACGAGGAGGTACTGGGATTCCTGCTTATCCGACGTCCTTCTTCCTTCGACTTCGAAGGCGCTTGGTTGTTCAACCATGGAATAGGAATACATTTG...

CDS

Download CDS FASTA

537 bp · TkA04G464120|TK1151|CDS

ATGGAGATTGTAAATGGAGGAGATGAAGTCGTCGAAGAGATATCTTCTTCTTCATGGAGGCACGACCAGTTGCCTTTATTATCTCTGAATCATGTCTCCTTCATCTGCAAATCTGTACGTCGATCTGTCGAGTTCTACGAGGAGGTACTGGGATTCCTGCTTATCCGACGTCCTTCTTCCTTCGACTTCGAAGGCGCTTGGTTGTTCAACCATGGAATAGGAATACATTTGCTAGAAATGGACACAATTCCAACAAAGAA...

Protein

Download Protein FASTA

179 aa · TkA04G464120|TK1151|PROTEIN

MEIVNGGDEVVEEISSSSWRHDQLPLLSLNHVSFICKSVRRSVEFYEEVLGFLLIRRPSSFDFEGAWLFNHGIGIHLLEMDTIPTKKGVINPKDNHISFQCSDMDLIIKKLENLGIKYITAMVKEGGVVVNQLFFHDPDGYMIEICNCHVLPVLPVSSRPLKKISATSQINYGDSYGMS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G464120`
TK1151 ID	TkA04G464120
OH-1004 ID	LXL04_038781
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 86.893 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G464120

Location Chr04:117157281-117161035 (-)

Description Similar to fosB: Metallothiol transferase FosB (Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15380`	Involved in the detoxification and scavenging of methylglyoxal (MG), a cytotoxic aldehyde produced in response to primary metabolism alteration observed during biotic and abiotic stresses.	Genome-wide association study reveals novel players in defense hormone crosstalk in Arabidopsis.2018 · DOI: 10.1111/pce.13357 GLYI4 Plays A Role in Methylglyoxal Detoxification and Jasmonate-Mediated Stress Responses in Arabidopsis thaliana .2019 · DOI: 10.3390/biom9100635

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038781 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010045 response to nickel cation Biological Process

GO:0010224 response to UV-B Biological Process

GO:0046677 response to antibiotic Biological Process

KEGG gene cross-reference

ath:AT1G15380

bld:BLi01518

bli:BL03635

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.366

Rank 1 · TkA04G464120 · TK1151

Cell membrane0.240

Rank 2 · TkA04G464120 · TK1151

Nucleus0.229

Rank 3 · TkA04G464120 · TK1151

Lysosome / Vacuole0.140

Rank 4 · TkA04G464120 · TK1151

Golgi apparatus0.126

Rank 5 · TkA04G464120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00903Glyoxalase29-145 aa

PF13669Glyoxalase_430-126 aa

PF18029Glyoxalase_633-145 aa

PF12681Glyoxalase_234-147 aa

PF22677Ble-like_N41-56 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G464120	`PF00903`	Glyoxalase	29	145	2.4e-12	48.0
TkA04G464120	`PF13669`	Glyoxalase_4	30	126	7.5e-05	23.7
TkA04G464120	`PF18029`	Glyoxalase_6	33	145	0.022	16.2
TkA04G464120	`PF12681`	Glyoxalase_2	34	147	2.4e-07	31.4
TkA04G464120	`PF22677`	Ble-like_N	41	56	0.0063	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI31`	Arabidopsis thaliana	sp\|Q9XI31\|GLYI4_ARATH Glyoxylase I 4	64.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card