TkA04G463870 | RubberDandelionOmics

Gene overview

TkA04G463870

Reference: TK1151 Chr: Chr04 Coordinates: 117113244-117113921 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA04G463870|TK1151|cDNA

ATGTCTTTACGCAGACCCCCAATTCCTCGACTACTTCTCAACAACGTTTCCTGCATGAGAAACGCCCAACAGATCTTACGCCATACCAACATCTCAATTCACGACGGTGGAGCCCTAGTACTCACCGGAGCAAACGGAAAAAGGTTGCAGCTTGCGAGAGTGATGGCCATGGATAGACCCATTTGGCTGCTTGATGAACCTTCTGTTGCTTTAGATGATGAATGTGTGAAGCTTTTGGAACAGATGATTGCGGATCATAG...

CDS

Download CDS FASTA

384 bp · TkA04G463870|TK1151|CDS

ATGTCTTTACGCAGACCCCCAATTCCTCGACTACTTCTCAACAACGTTTCCTGCATGAGAAACGCCCAACAGATCTTACGCCATACCAACATCTCAATTCACGACGGTGGAGCCCTAGTACTCACCGGAGCAAACGGAAAAAGGTTGCAGCTTGCGAGAGTGATGGCCATGGATAGACCCATTTGGCTGCTTGATGAACCTTCTGTTGCTTTAGATGATGAATGTGTGAAGCTTTTGGAACAGATGATTGCGGATCATAG...

Protein

Download Protein FASTA

127 aa · TkA04G463870|TK1151|PROTEIN

MSLRRPPIPRLLLNNVSCMRNAQQILRHTNISIHDGGALVLTGANGKRLQLARVMAMDRPIWLLDEPSVALDDECVKLLEQMIADHRSQGGIVIVATHLPIAIEDAMILRLPPRFPRRITLVDMLPH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G463870`
TK1151 ID	TkA04G463870
OH-1004 ID	LXL04_002796
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.800
Protein coverage (%)	TK1151 95.276 / OH-1004 77.385 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G463870

Location Chr04:117113244-117113921 (+)

Description Similar to ABCI1: ABC transporter I family member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63270`	Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this does not seem to be the case, but its exact role is uncertain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002796 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0017004 cytochrome complex assembly Biological Process

GO:1903607 cytochrome c biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0015439 ABC-type heme transporter activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G63270

gox:GOX1571

mag:amb4180

nmu:Nmul_A1217

rpd:RPD_0524

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.498

Rank 1 · TkA04G463870 · TK1151

Cytoplasm0.174

Rank 2 · TkA04G463870 · TK1151

Nucleus0.107

Rank 3 · TkA04G463870 · TK1151

Plastid0.085

Rank 4 · TkA04G463870 · TK1151

Peroxisome0.046

Rank 5 · TkA04G463870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005ABC_tran39-68 aa

PF02463SMC_N48-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G463870	`PF00005`	ABC_tran	39	68	0.0016	19.8
TkA04G463870	`PF02463`	SMC_N	48	98	0.0004	20.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8T1`	Arabidopsis thaliana	sp\|Q9C8T1\|AB1I_ARATH ABC transporter I family member 1	46.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card