TkA04G463210 | RubberDandelionOmics

Gene overview

TkA04G463210

Reference: TK1151 Chr: Chr04 Coordinates: 116936851-116937992 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA04G463210|TK1151|cDNA

ATGGAGAGGTTCTTAGCAGACAACATAGTTCCTAGTTTGGTCCGAGATCTGAGCCCAAGTTCTTGTACCCCGACGGTGGTTGCTATTGGACCTCTTCACAACAAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACAGTTTATTTCCATAAATGGTTGCAGCATTTGGGTATTAATGATGCAGAGGAAACAATGCGAGACTGTGTGGAGAAGGTGATTCATTCAATAGAAGGAATCAAGGCATGTTATGCAGGGTT...

CDS

Download CDS FASTA

684 bp · TkA04G463210|TK1151|CDS

ATGGAGAGGTTCTTAGCAGACAACATAGTTCCTAGTTTGGTCCGAGATCTGAGCCCAAGTTCTTGTACCCCGACGGTGGTTGCTATTGGACCTCTTCACAACAAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACAGTTTATTTCCATAAATGGTTGCAGCATTTGGGTATTAATGATGCAGAGGAAACAATGCGAGACTGTGTGGAGAAGGTGATTCATTCAATAGAAGGAATCAAGGCATGTTATGCAGGGTT...

Protein

Download Protein FASTA

227 aa · TkA04G463210|TK1151|PROTEIN

MERFLADNIVPSLVRDLSPSSCTPTVVAIGPLHNKDEHLQEFEVQKTVYFHKWLQHLGINDAEETMRDCVEKVIHSIEGIKACYAGLMTYTDSELAKMMVIPQFQRPTMRMPKLQIHDFSELILRNLIVYEQSSSDVGKYVTSYVCALDMLIDTREDVAVLIKSQVLTSYFGSNEEAADMINKLCKNIPFPDFFYDQQWEGMDAYYNSYWPNTLTVHISIIPGISLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G463210`
TK1151 ID	TkA04G463210
OH-1004 ID	LXL04_038777
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	78.600
Protein coverage (%)	TK1151 90.749 / OH-1004 72.628 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G463210`
Location	Chr04:116936851-116937992 (+)
Description	Similar to At3g47200: UPF0481 protein At3g47200
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038777` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT3G02645 ath:AT3G47200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.710

Rank 1 · TkA04G463210 · TK1151

Cytoplasm0.158

Rank 2 · TkA04G463210 · TK1151

Endoplasmic reticulum0.077

Rank 3 · TkA04G463210 · TK1151

Nucleus0.069

Rank 4 · TkA04G463210 · TK1151

Extracellular0.044

Rank 5 · TkA04G463210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03140DUF24710-101 aa

PF29947C5orf2241-97 aa

PF03558TBSV_P2290-173 aa

PF03140DUF247104-212 aa

PF29947C5orf22189-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G463210	`PF03140`	DUF247	10	101	3.2e-48	165.8
TkA04G463210	`PF29947`	C5orf22	41	97	0.23	12.8
TkA04G463210	`PF03558`	TBSV_P22	90	173	0.079	13.2
TkA04G463210	`PF03140`	DUF247	104	212	3.2e-48	165.8
TkA04G463210	`PF29947`	C5orf22	189	209	0.23	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card