TkA04G462970 | RubberDandelionOmics

Gene overview

TkA04G462970

Reference: TK1151 Chr: Chr04 Coordinates: 116886013-116887221 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1128 bp · TkA04G462970|TK1151|cDNA

ATGGTTCCTAGTTTGGTCCGAGATCTGAGCCCAAGTTCTTTTACCCCTACGGTGGTTGCTATTGGACCTCTTCACAGCAAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACAGCTTATTTCCATAAGTTGTTGCATCGTTTCGATATGGTGCGAGAGGAAACAATGCGAAACTGTGTGGAGAAGACTTACACCGATTCTGAGCTAGCAAAGATGATGGTAATAGATGCTTGTTTCATACTTGAGTTTATTCAGAG...

CDS

Download CDS FASTA

1128 bp · TkA04G462970|TK1151|CDS

ATGGTTCCTAGTTTGGTCCGAGATCTGAGCCCAAGTTCTTTTACCCCTACGGTGGTTGCTATTGGACCTCTTCACAGCAAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACAGCTTATTTCCATAAGTTGTTGCATCGTTTCGATATGGTGCGAGAGGAAACAATGCGAAACTGTGTGGAGAAGACTTACACCGATTCTGAGCTAGCAAAGATGATGGTAATAGATGCTTGTTTCATACTTGAGTTTATTCAGAG...

Protein

Download Protein FASTA

375 aa · TkA04G462970|TK1151|PROTEIN

MVPSLVRDLSPSSFTPTVVAIGPLHSKDEHLQEFEVQKTAYFHKLLHRFDMVREETMRNCVEKTYTDSELAKMMVIDACFILEFIQSGTNISLSRPNIMITQSIGQDLFMIENQIPFFVLKIIFDCTIFASGRMRDSFTKYIKVLLSFHNFIEEHEVQPDALSPDPDHILGFLHKYFRPAKPMPSTFRSSIKCHTAIELDRAGVKFKPINENKNWVLDMKLELPLPLCSWGRTMRMPKLRIHDSSELILRNLVVYEDSSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G462970`
TK1151 ID	TkA04G462970
OH-1004 ID	LXL04_038766
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 98.667 / OH-1004 71.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G462970`
Location	Chr04:116886013-116887221 (+)
Description	Similar to BOP1: Ribosome biogenesis protein BOP1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038766` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000027 ribosomal large subunit assembly Biological Process GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000460 maturation of 5.8S rRNA Biological Process GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0007276 gamete generation Biological Process GO:0008283 cell population proliferation Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:0051302 regulation of cell division Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT2G40360 dosa:Os07g0435400 mbr:MONBRDRAFT_37129 mmu:12181 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.814

Rank 1 · TkA04G462970 · TK1151

Cytoplasm0.136

Rank 2 · TkA04G462970 · TK1151

Nucleus0.074

Rank 3 · TkA04G462970 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA04G462970 · TK1151

Extracellular0.031

Rank 5 · TkA04G462970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03140DUF2472-363 aa

PF26179RESC1026-115 aa

PF19970VMAP-M9281-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G462970	`PF03140`	DUF247	2	363	6.5e-85	286.6
TkA04G462970	`PF26179`	RESC10	26	115	0.004	16.5
TkA04G462970	`PF19970`	VMAP-M9	281	343	0.081	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card