TkA04G462660 | RubberDandelionOmics

Gene overview

TkA04G462660

Reference: TK1151 Chr: Chr04 Coordinates: 116784114-116789009 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2498 bp · TkA04G462660|TK1151|cDNA

GGCAAAGTTGCAAAAATCAAAATATTAGCGAAGTAGAGCGGAACCTTTACACGGATCGGACATCCAAATAACGTCACTTGCCCATAATCTTCCCCTCTTTCTGAACAATCGCCGTTAGATCCAAATCCCATCGCCGGCGATCCCGATGTGGCCCAGCGTCCCTTCCTCCTCCGGTCTCACCGTCGTCACATTGTTCATCGCTTCGTTCCTCCTCATTTCATCGCCGGTGGTCTCTTCCGACTCTGATCACAAGTATCAAC...

CDS

Download CDS FASTA

1785 bp · TkA04G462660|TK1151|CDS

ATGTGGCCCAGCGTCCCTTCCTCCTCCGGTCTCACCGTCGTCACATTGTTCATCGCTTCGTTCCTCCTCATTTCATCGCCGGTGGTCTCTTCCGACTCTGATCACAAGTATCAACAAGATGACACTGTTGACCTATGGGTGAATAAAGTTGGGCCTTATAATAATCCACAAGAAACATATAATTATTACAGCCTTCCATTTTGTCGCCCACCTGGTCATGCTGGCCACAAATGGGGTGGTCTTGGTGAAGTATTGGGTGG...

Protein

Download Protein FASTA

594 aa · TkA04G462660|TK1151|PROTEIN

MWPSVPSSSGLTVVTLFIASFLLISSPVVSSDSDHKYQQDDTVDLWVNKVGPYNNPQETYNYYSLPFCRPPGHAGHKWGGLGEVLGGNELIDSQIDVKFQKNVEKTTICDLELDEPKVSQFTHAIEHNYWFEFFMDDLPLWGFVGELHSDRNNDNKHMLFTHKNITIKYNKDQIIHVNLTQENPKPLEVGRKLDMTYSVKWSETNITFGRRFDVYLDYHFFEHQIHWFSIFNSFMMVIFLTGLVSMILMRTLRNDYAKYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G462660`
TK1151 ID	TkA04G462660
OH-1004 ID	LXL04_038757
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 98.653 / OH-1004 94.003 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G462660

Location Chr04:116784114-116789009 (+)

Description Similar to TMN1: Transmembrane 9 superfamily member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10950`	Transmembrane 9 superfamily member 1.	No verified direct reference in this release
`At5g37310`	Transmembrane 9 superfamily member 4.	No verified direct reference in this release
`At2g01970`	Transmembrane 9 superfamily member 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038757 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0072657 protein localization to membrane Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G10950

ath:AT2G01970

ath:AT5G37310

hsa:56889

mmu:107358

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.327

Rank 1 · TkA04G462660 · TK1151

Golgi apparatus0.326

Rank 2 · TkA04G462660 · TK1151

Endoplasmic reticulum0.201

Rank 3 · TkA04G462660 · TK1151

Cytoplasm0.184

Rank 4 · TkA04G462660 · TK1151

Cell membrane0.109

Rank 5 · TkA04G462660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07172GRP11-72 aa

PF06678DUF117912-54 aa

PF02990EMP7059-551 aa

PF27009DUF832992-168 aa

PF27009DUF8329193-215 aa

PF07690MFS_1231-422 aa

PF06678DUF1179232-257 aa

PF07172GRP309-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G462660	`PF07172`	GRP	11	72	0.67	11.3
TkA04G462660	`PF06678`	DUF1179	12	54	0.28	11.9
TkA04G462660	`PF02990`	EMP70	59	551	4.9e-179	597.0
TkA04G462660	`PF27009`	DUF8329	92	168	0.062	14.1
TkA04G462660	`PF27009`	DUF8329	193	215	0.062	14.1
TkA04G462660	`PF07690`	MFS_1	231	422	0.0042	16.8
TkA04G462660	`PF06678`	DUF1179	232	257	0.28	11.9
TkA04G462660	`PF07172`	GRP	309	318	0.67	11.3
TkA04G462660	`PF07172`	GRP	345	357	0.67	11.3
TkA04G462660	`PF07690`	MFS_1	407	574	0.0042	16.8
TkA04G462660	`PF06678`	DUF1179	474	496	0.28	11.9
TkA04G462660	`PF07172`	GRP	490	500	0.67	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940G0`	Arabidopsis thaliana	sp\|Q940G0\|TMN1_ARATH Transmembrane 9 superfamily member 1	86.400%	Swiss-Prot	High
`Q9FHT4`	Arabidopsis thaliana	sp\|Q9FHT4\|TMN4_ARATH Transmembrane 9 superfamily member 4	42.200%	Swiss-Prot	Medium
`Q9ZPS7`	Arabidopsis thaliana	sp\|Q9ZPS7\|TMN3_ARATH Transmembrane 9 superfamily member 3	39.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card