TkA04G461480 | RubberDandelionOmics

Gene overview

TkA04G461480

Reference: TK1151 Chr: Chr04 Coordinates: 116397816-116403076 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3740 bp · TkA04G461480|TK1151|cDNA

CGACGATAAAAAAGGAGTAATATAAGAAGTTGAAAATAAAGAGTATGGAGAAGTTAAAGGATCATATTTTTACAAACCGATCATAGAAAAACTACAACACGTTCTGCCACCCCTAAAAGCAAAAACCCTCATGGCTCTTCTCCGAGCATATACGTACAGATATAGACATACATAGAGGAAGAACGATAGTAAGGGAGGGGAGGCAACAATGGCGCAATCATTAGAGCTTCTGATACTTCAATTCTTGATGCCGGACGATG...

CDS

Download CDS FASTA

3126 bp · TkA04G461480|TK1151|CDS

ATGGCGCAATCATTAGAGCTTCTGATACTTCAATTCTTGATGCCGGACGATGACGCGCGCCGGCAAGCGGAGGACCAAATCAAGCGGATGGCTAGGGATCCAACGGTGGTTCCGATACTTATCGACCACATACGTGCTGCAAAGACGCCCAATGTCCGACAACTCTGTGCCGTTCTCCTCCGTAAGAAAATCACCGGTCACTGGCCCAATCTTCTTCCCGACATCCGCCAGCTCGTCATGCAATCTCTCATTGAAAGCAT...

Protein

Download Protein FASTA

1041 aa · TkA04G461480|TK1151|PROTEIN

MAQSLELLILQFLMPDDDARRQAEDQIKRMARDPTVVPILIDHIRAAKTPNVRQLCAVLLRKKITGHWPNLLPDIRQLVMQSLIESIATENSSSVRRASANAASIVAKYAIPRGQWPDLLPFIFDCSLSAQEDHREVALMLFSSLTETLGDSFRPYFAHFQLLLLNCLQDEISSVRVAALKAVGAFIEAIHDESEVVKFCDFIPSILNVARQYLASGDEDIAIIAFEIFDELIEFPAPLLGESIKAIVHFSLEVFSCSNY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G461480`
TK1151 ID	TkA04G461480
OH-1004 ID	LXL04_014369
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	23.400
Protein coverage (%)	TK1151 99.232 / OH-1004 97.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G461480`
Location	Chr04:116397816-116403076 (+)
Description	Similar to Ipo5: Importin-5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014369` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002753 cytoplasmic pattern recognition receptor signaling pathway Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006607 NLS-bearing protein import into nucleus Biological Process GO:0006610 ribosomal protein import into nucleus Biological Process GO:0042307 positive regulation of protein import into nucleus Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component
KEGG gene cross-reference	hsa:26953 hsa:3843 mmu:240614 mmu:70572 spo:2539387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.680

Rank 1 · TkA04G461480 · TK1151

Cytoplasm0.565

Rank 2 · TkA04G461480 · TK1151

Cell membrane0.039

Rank 3 · TkA04G461480 · TK1151

Mitochondrion0.035

Rank 4 · TkA04G461480 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA04G461480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13646HEAT_210-102 aa

PF22958Ltn1_1st14-99 aa

PF24714TOR1L1_N16-110 aa

PF03810IBN_N23-88 aa

PF24492HEAT_ECM2935-110 aa

PF02985HEAT37-60 aa

PF10274ParcG43-113 aa

PF25801HEAT_GCN1_C_243-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G461480	`PF13646`	HEAT_2	10	102	2.1e-12	47.9
TkA04G461480	`PF22958`	Ltn1_1st	14	99	0.0026	18.0
TkA04G461480	`PF24714`	TOR1L1_N	16	110	6e-24	85.6
TkA04G461480	`PF03810`	IBN_N	23	88	7.8e-10	39.3
TkA04G461480	`PF24492`	HEAT_ECM29	35	110	2e-17	64.5
TkA04G461480	`PF02985`	HEAT	37	60	7.2e-22	76.1
TkA04G461480	`PF10274`	ParcG	43	113	1.4e-06	29.3
TkA04G461480	`PF25801`	HEAT_GCN1_C_2	43	102	1.4e-05	25.4
TkA04G461480	`PF13251`	DUF4042	45	104	8.4e-05	23.1
TkA04G461480	`PF12348`	CLASP_N	58	111	0.00057	20.2
TkA04G461480	`PF24984`	HEAT_EF3_GNC1	62	77	5.6e-07	30.5
TkA04G461480	`PF13513`	HEAT_EZ	69	102	2.1e-25	89.4
TkA04G461480	`PF07571`	TAF6_C	70	106	0.0011	19.5
TkA04G461480	`PF30357`	RELCH_N	72	106	9.3e-06	26.3
TkA04G461480	`PF12054`	DUF3535	74	102	0.038	14.0
TkA04G461480	`PF26715`	HEAT_GCN1_2	75	104	0.023	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card