TkA04G447900 | RubberDandelionOmics

Gene overview

TkA04G447900

Reference: TK1151 Chr: Chr04 Coordinates: 112922933-112926697 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA04G447900|TK1151|cDNA

ATGAGAAAAGCTCTTGGTCTCTGCAGGGGTGCAATTGAGAGACTTGAAACAGAGCTTAGAGATGATACTTGCACTTCAAATCTAACCTCCATGGTGAGAGTTGATCATATGGCAATTGCATTATCAAGAGCTTACAAATCACCAATAGTTGACACAATTCAGTCCATTCCACAACATCAACAAATTGTTCTATGTTCTGCAGTAAAGCTTTTCCGTAAGGGAAAAAAGGATACAACAATAGGAGAGTTGAACAAATTTTA...

CDS

Download CDS FASTA

474 bp · TkA04G447900|TK1151|CDS

ATGAGAAAAGCTCTTGGTCTCTGCAGGGGTGCAATTGAGAGACTTGAAACAGAGCTTAGAGATGATACTTGCACTTCAAATCTAACCTCCATGGTGAGAGTTGATCATATGGCAATTGCATTATCAAGAGCTTACAAATCACCAATAGTTGACACAATTCAGTCCATTCCACAACATCAACAAATTGTTCTATGTTCTGCAGTAAAGCTTTTCCGTAAGGGAAAAAAGGATACAACAATAGGAGAGTTGAACAAATTTTA...

Protein

Download Protein FASTA

157 aa · TkA04G447900|TK1151|PROTEIN

MRKALGLCRGAIERLETELRDDTCTSNLTSMVRVDHMAIALSRAYKSPIVDTIQSIPQHQQIVLCSAVKLFRKGKKDTTIGELNKFYIEVCKSSLIPPVGIMELACMCRVLGDQGILKLGQSRDDKLKRVTLKIDEADIIFALQVCKTSKHDYCCLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G447900`
TK1151 ID	TkA04G447900
OH-1004 ID	LXL04_005710
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.100
Protein coverage (%)	TK1151 91.720 / OH-1004 30.063 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G447900

Location Chr04:112922933-112926697 (+)

Description Similar to CDC6B: Cell division control protein 6 homolog B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07270`	May be involved in the initiation of DNA replication.	No verified direct reference in this release
`At2g29680`	May be involved in the initiation of DNA replication.	Expression and stability of Arabidopsis CDC6 are associated with endoreplication.2001 · DOI: 10.1105/tpc.010329

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0856000`	May be involved in the initiation of DNA replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005710 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000076 DNA replication checkpoint signaling Biological Process

GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0007089 traversing start control point of mitotic cell cycle Biological Process

GO:0008156 negative regulation of DNA replication Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

GO:0032467 positive regulation of cytokinesis Biological Process

GO:0033314 mitotic DNA replication checkpoint signaling Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process

GO:0048146 positive regulation of fibroblast proliferation Biological Process

KEGG gene cross-reference

ath:AT1G07270

ath:AT2G29680

dosa:Os01g0856000

hsa:990

mmu:23834

osa:4324832

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.616

Rank 1 · TkA04G447900 · TK1151

Cytoplasm0.383

Rank 2 · TkA04G447900 · TK1151

Mitochondrion0.035

Rank 3 · TkA04G447900 · TK1151

Cell membrane0.026

Rank 4 · TkA04G447900 · TK1151

Lysosome / Vacuole0.021

Rank 5 · TkA04G447900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09079WHD_Cdc651-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G447900	`PF09079`	WHD_Cdc6	51	142	9.3e-22	77.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W032`	Arabidopsis thaliana	sp\|Q8W032\|CDC6B_ARATH DNA replication factor CDC6B	60.400%	Swiss-Prot	High
`O82387`	Arabidopsis thaliana	sp\|O82387\|CDC6A_ARATH DNA replication factor CDC6	60.400%	Swiss-Prot	High
`Q5N897`	Oryza sativa subsp. japonica	sp\|Q5N897\|CDC6_ORYSJ DNA replication factor CDC6	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card