TkA04G444620 | RubberDandelionOmics

Gene overview

TkA04G444620

Reference: TK1151 Chr: Chr04 Coordinates: 112079779-112080349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA04G444620|TK1151|cDNA

ATGCGTATAATGGGTAACCAACACAGAGGCGGTCATATTTTTAACATGGATGGCGTCGGCTCCCGTGGCTCAAGCACACCTTTGACCGCCGTCTACGGGTCAACAAAATGCGGACTTCGACAACTCCAATCATCGTTATTCAAAGAATGCAAGAAATCTAAAGTCGGAGTTCATACAGCTTCTCCAGGCATGGTTCTCACCGATTTGCTCTTGAGTGGATCAAGTATTCAAAACAAACAAATGTTTAACATAATATGCGA...

CDS

Download CDS FASTA

408 bp · TkA04G444620|TK1151|CDS

ATGCGTATAATGGGTAACCAACACAGAGGCGGTCATATTTTTAACATGGATGGCGTCGGCTCCCGTGGCTCAAGCACACCTTTGACCGCCGTCTACGGGTCAACAAAATGCGGACTTCGACAACTCCAATCATCGTTATTCAAAGAATGCAAGAAATCTAAAGTCGGAGTTCATACAGCTTCTCCAGGCATGGTTCTCACCGATTTGCTCTTGAGTGGATCAAGTATTCAAAACAAACAAATGTTTAACATAATATGCGA...

Protein

Download Protein FASTA

135 aa · TkA04G444620|TK1151|PROTEIN

MRIMGNQHRGGHIFNMDGVGSRGSSTPLTAVYGSTKCGLRQLQSSLFKECKKSKVGVHTASPGMVLTDLLLSGSSIQNKQMFNIICELPETVARTLFPRMRVVKGSGKAINYLTPPRILVTAWLGRKQWFDDEVY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G444620`
TK1151 ID	TkA04G444620
OH-1004 ID	LXL04_002546
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.000
Protein coverage (%)	TK1151 98.519 / OH-1004 23.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G444620

Location Chr04:112079779-112080349 (-)

Description Similar to NYC1: Probable chlorophyll(ide) b reductase NYC1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13250`	Involved in chlorophyll b degradation.	Participation of chlorophyll b reductase in the initial step of the degradation of light-harvesting chlorophyll a/b-protein complexes in Arabidopsis.2009 · DOI: 10.1074/jbc.m109.008912
`At5g04900`	Required for chlorophyll b degradation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0227100`	Required for proper chloroplast degradation.	No verified direct reference in this release
`Os03g0654600`	Required for chlorophyll b degradation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002546 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010304 PSII associated light-harvesting complex II catabolic process Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0034256 chlorophyll(ide) b reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G13250

ath:AT5G04900

dosa:Os01g0227100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.620

Rank 1 · TkA04G444620 · TK1151

Endoplasmic reticulum0.225

Rank 2 · TkA04G444620 · TK1151

Cytoplasm0.097

Rank 3 · TkA04G444620 · TK1151

Nucleus0.057

Rank 4 · TkA04G444620 · TK1151

Cell membrane0.053

Rank 5 · TkA04G444620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short7-70 aa

PF13561adh_short_C28-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G444620	`PF00106`	adh_short	7	70	1.6e-07	31.7
TkA04G444620	`PF13561`	adh_short_C2	8	72	5.3e-05	23.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZA0`	Arabidopsis thaliana	sp\|Q93ZA0\|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic	78.700%	Swiss-Prot	High
`Q8LEU3`	Arabidopsis thaliana	sp\|Q8LEU3\|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic	44.300%	Swiss-Prot	Medium
`Q5N800`	Oryza sativa subsp. japonica	sp\|Q5N800\|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic	80.100%	Swiss-Prot	High
`Q84ST4`	Oryza sativa subsp. japonica	sp\|Q84ST4\|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic	45.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card