TkA04G442850 | RubberDandelionOmics

Gene overview

TkA04G442850

Reference: TK1151 Chr: Chr04 Coordinates: 111654724-111655089 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA04G442850|TK1151|cDNA

ATGGCTGGCCACGGCGTTGCTCCTCCTCCTTGCCCGCCACCTCCGTGTCCCCGAAAACTCAACCCACCTCCCGGCCCCAAACCTTGGCCTATTATCGGAAACCTTAACCTAATAGGCACACTCCCTCACCGCTCAATCCATGACCTGTCACAAAAATACGGCGAAATAATGCAACTCAAATTCGGTTCATTCAACGTCGTCGTCGGATCCTCACCTGCCATGGCGAAAGTGTTCCTTAAAACGATGGACGTCAACTTCGC...

CDS

Download CDS FASTA

366 bp · TkA04G442850|TK1151|CDS

ATGGCTGGCCACGGCGTTGCTCCTCCTCCTTGCCCGCCACCTCCGTGTCCCCGAAAACTCAACCCACCTCCCGGCCCCAAACCTTGGCCTATTATCGGAAACCTTAACCTAATAGGCACACTCCCTCACCGCTCAATCCATGACCTGTCACAAAAATACGGCGAAATAATGCAACTCAAATTCGGTTCATTCAACGTCGTCGTCGGATCCTCACCTGCCATGGCGAAAGTGTTCCTTAAAACGATGGACGTCAACTTCGC...

Protein

Download Protein FASTA

121 aa · TkA04G442850|TK1151|PROTEIN

MAGHGVAPPPCPPPPCPRKLNPPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGEIMQLKFGSFNVVVGSSPAMAKVFLKTMDVNFACRPKTAAGKYTTYNYSNMTWSPYDLTGAKLVKYV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G442850`
TK1151 ID	TkA04G442850
OH-1004 ID	LXL04_038568
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 77.686 / OH-1004 18.395 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G442850

Location Chr04:111654724-111655089 (-)

Description Similar to CYP92C6: Trimethyltridecatetraene synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07990`	Catalyzes the 3'-hydroxylation of the flavonoid B-ring to the 3',4'-hydroxylated state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038568 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0010333 terpene synthase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0033772 flavonoid 3',5'-hydroxylase activity Molecular Function

GO:0097007 4,8,12-trimethyltrideca-1,3,7,11-tetraene synthase activity Molecular Function

GO:0102171 DMNT synthase activity Molecular Function

KEGG gene cross-reference

zma:100279968

zma:103631958

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.746

Rank 1 · TkA04G442850 · TK1151

Plastid0.077

Rank 2 · TkA04G442850 · TK1151

Extracellular0.050

Rank 3 · TkA04G442850 · TK1151

Lysosome / Vacuole0.043

Rank 4 · TkA04G442850 · TK1151

Cytoplasm0.036

Rank 5 · TkA04G442850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45023-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G442850	`PF00067`	p450	23	99	9.3e-12	45.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD85`	Arabidopsis thaliana	sp\|Q9SD85\|F3PH_ARATH Flavonoid 3'-monooxygenase	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card