TkA04G442470 | RubberDandelionOmics

Gene overview

TkA04G442470

Reference: TK1151 Chr: Chr04 Coordinates: 111569575-111571505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1645 bp · TkA04G442470|TK1151|cDNA

CAGAAAAAAACACTTCATCCCAGTTCCTCGTAACCAAAAGGTTTTAGGGAGTGGATTCTATTCCAATCTGATTACGTGTCCTTACTCAATCCTTTTTTTTCTTCATCAAAAACTTTTATGGAGATTTCACAATTCAGAGGCTTTTCAGAATTGTCAGGAATTGAGGACCCGTGTTTCAATTCCCAATGGCCATTCAATTCCTTCGACGATCAACTCAATTCGATGAACATGGAAGCAGCTGCATTTGGAGAAAACACACA...

CDS

Download CDS FASTA

1047 bp · TkA04G442470|TK1151|CDS

ATGGAGATTTCACAATTCAGAGGCTTTTCAGAATTGTCAGGAATTGAGGACCCGTGTTTCAATTCCCAATGGCCATTCAATTCCTTCGACGATCAACTCAATTCGATGAACATGGAAGCAGCTGCATTTGGAGAAAACACACATGATTTCTACTCTCCTCATGTATCTATATTCGATCATTATAAACCAGTTATGGAACCGTCTCCTCGACCTACTAAACAACCCAAAACCACCAGCTGGAATTCATGCATCACCCCTGA...

Protein

Download Protein FASTA

348 aa · TkA04G442470|TK1151|PROTEIN

MEISQFRGFSELSGIEDPCFNSQWPFNSFDDQLNSMNMEAAAFGENTHDFYSPHVSIFDHYKPVMEPSPRPTKQPKTTSWNSCITPDHDQSIVNHNHNLHYANDSVIAIVTPKEEGTVSSKRTFGFASDNTFQSSHVQFGNQNHHGGAGGGGKTTTVSNTPRVLTTPQDHILAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKYLKNLQEKVKTLEEQSKKKTNVESVVFVKRYEVLADGGEISSSDENFSGGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G442470`
TK1151 ID	TkA04G442470
OH-1004 ID	LXL04_017259
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G442470

Location Chr04:111569575-111571505 (+)

Description Similar to BHLH25: Transcription factor bHLH25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37850`	Transcription factor bHLH25.	No verified direct reference in this release
`At2g22750`	Transcription factor bHLH18.	No verified direct reference in this release
`At2g22760`	Transcription factor bHLH19.	No verified direct reference in this release
`At2g22770`	Transcription activator that regulates the expression of at least NAI2, PYK10 and PBP1.	A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01636.x NAI1 gene encodes a basic-helix-loop-helix-type putative transcription factor that regulates the formation of an endoplasmic reticulum-derived structure, the ER body.2004 · DOI: 10.1105/tpc.021154 Activation of an ER-body-localized beta-glucosidase via a cytosolic binding partner in damaged tissues of Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci126 PYK10, a beta-glucosidase located in the endoplasmatic reticulum, is crucial for the beneficial interaction between Arabidopsis thaliana and the endophytic fungus Piriformospora indica.2008 · DOI: 10.1111/j.1365-313x.2008.03424.x Antagonistic jacalin-related lectins regulate the size of ER body-type beta-glucosidase complexes in Arabidopsis thaliana.2008 · DOI: 10.1093/pcp/pcn075 NAI2 is an endoplasmic reticulum body component that enables ER body formation in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.059345
`At1g32640`	Transcriptional activator.	Arabidopsis AtMYC2 (bHLH) and AtMYB2 (MYB) function as transcriptional activators in abscisic acid signaling.2003 · DOI: 10.1105/tpc.006130 JASMONATE-INSENSITIVE1 encodes a MYC transcription factor essential to discriminate between different jasmonate-regulated defense responses in Arabidopsis.2004 · DOI: 10.1105/tpc.022319 A basic helix-loop-helix transcription factor in Arabidopsis, MYC2, acts as a repressor of blue light-mediated photomorphogenic growth.2005 · DOI: 10.1105/tpc.105.032060 Characterization of JAZ-interacting bHLH transcription factors that regulate jasmonate responses in Arabidopsis.2011 · DOI: 10.1093/jxb/erq408 The Arabidopsis bHLH transcription factors MYC3 and MYC4 are targets of JAZ repressors and act additively with MYC2 in the activation of jasmonate responses.2011 · DOI: 10.1105/tpc.110.080788 The basic helix-loop-helix transcription factor MYC2 directly represses PLETHORA expression during jasmonate-mediated modulation of the root stem cell niche in Arabidopsis.2011 · DOI: 10.1105/tpc.111.089870 Arabidopsis MYC2 interacts with DELLA proteins in regulating sesquiterpene synthase gene expression.2012 · DOI: 10.1105/tpc.112.098749 Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior.2013 · DOI: 10.1105/tpc.113.115139 Role of arabidopsis MYC and MYB homologs in drought- and abscisic acid-regulated gene expression.1997 · DOI: 10.1105/tpc.9.10.1859

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017259 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G22750

ath:AT2G22760

ath:AT2G22770

ath:AT4G37850

ath:AT5G57150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA04G442470 · TK1151

Cytoplasm0.085

Rank 2 · TkA04G442470 · TK1151

Cell membrane0.024

Rank 3 · TkA04G442470 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA04G442470 · TK1151

Plastid0.010

Rank 5 · TkA04G442470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23181bHLH_INO4169-216 aa

PF00010HLH170-215 aa

PF23177bHLH_IRO3173-227 aa

PF23173bHLH_SAC51174-217 aa

PF24931ACT_ACR9_3rd198-239 aa

PF01729QRPTase_C207-321 aa

PF24931ACT_ACR9_3rd269-345 aa

PF22754bHLH-TF_ACT-like_plant273-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G442470	`PF23181`	bHLH_INO4	169	216	0.089	13.6
TkA04G442470	`PF00010`	HLH	170	215	1e-10	42.0
TkA04G442470	`PF23177`	bHLH_IRO3	173	227	3e-09	37.8
TkA04G442470	`PF23173`	bHLH_SAC51	174	217	1.1e-06	29.2
TkA04G442470	`PF24931`	ACT_ACR9_3rd	198	239	0.1	13.4
TkA04G442470	`PF01729`	QRPTase_C	207	321	0.031	14.7
TkA04G442470	`PF24931`	ACT_ACR9_3rd	269	345	0.1	13.4
TkA04G442470	`PF22754`	bHLH-TF_ACT-like_plant	273	333	0.00056	20.7
TkA04G442470	`PF23177`	bHLH_IRO3	298	338	3e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T072`	Arabidopsis thaliana	sp\|Q9T072\|BH025_ARATH Transcription factor bHLH25	53.900%	Swiss-Prot	Medium
`Q1PF17`	Arabidopsis thaliana	sp\|Q1PF17\|BH018_ARATH Transcription factor bHLH18	50.800%	Swiss-Prot	Medium
`Q1PF16`	Arabidopsis thaliana	sp\|Q1PF16\|BH019_ARATH Transcription factor bHLH19	48.100%	Swiss-Prot	Medium
`Q8S3F1`	Arabidopsis thaliana	sp\|Q8S3F1\|BH020_ARATH Transcription factor NAI1	46.000%	Swiss-Prot	Medium
`Q39204`	Arabidopsis thaliana	sp\|Q39204\|MYC2_ARATH Transcription factor MYC2	37.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card