TkA04G441800 | RubberDandelionOmics

Gene overview

TkA04G441800

Reference: TK1151 Chr: Chr04 Coordinates: 111396624-111400460 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1495 bp · TkA04G441800|TK1151|cDNA

TCTTTCAGAAATTCATCCATAAGTTTCAACCACAAATCAGCAAAACAGTCAAAGGAGAGAGAAACACAAGGTCAACAAACCCGTCAAAGGAGAGAGAGGGTGCTGACAAAAATCGAATAGGAAAAGGAATCATAAGTTTCAACCACAAATCAGCACGTTGATGACCATCGCCATCACTATCTGTATCAACGAAGGCCATACCATTCTTCGATTCCTATGCTACTGGAATCGATCAGATCCTCCACTATCAGCTTCCGGTA...

CDS

Download CDS FASTA

861 bp · TkA04G441800|TK1151|CDS

ATGGATTCAACTCCAAGTTTGTATCCATTGCATCGATCCAAGACTCTTCACCTGGTTAGGCATGCACAAGGAGTTCACAATGTAATGGGAGACAAAGATTACAAAGCCTACATGTCAGCTGAATACTTTGATGCTGAGTTAACTCGATTGGGTTGGCTACAGGTTGAAAATTTGCGTAAACATGTGCATGATTGTGGGCTTGCCAAAAAGATTGATGTAGTTATTACATCTCCGTTATTAAGGACTATTCAAACAGCAGT...

Protein

Download Protein FASTA

286 aa · TkA04G441800|TK1151|PROTEIN

MDSTPSLYPLHRSKTLHLVRHAQGVHNVMGDKDYKAYMSAEYFDAELTRLGWLQVENLRKHVHDCGLAKKIDVVITSPLLRTIQTAVGVFGGEGYTDKVDAMPLMLANVGNSGRSAISSLNCPPIVAVELCREHLGVHPCDRRRSVGEYQCMFPAVDFSLIESDEDVLWKANERETKEDLASRGKKFLNWLWTREEKEIAIVTHSGFLFHTLATFGNDCHPLVKKEINKHFANCELRSMVIVDKSMLGSDSSTTDYPGKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G441800`
TK1151 ID	TkA04G441800
OH-1004 ID	LXL04_038555
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G441800

Location Chr04:111396624-111400460 (-)

Description Similar to At5g64460: Phosphoglycerate mutase-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64460`	May play a role in carbohydrates metabolism.	No verified direct reference in this release
`At2g17280`	May play a role in carbohydrates metabolism.	No verified direct reference in this release
`At1g58280`	May play a role in carbohydrates metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038555 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016791 phosphatase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

abe:ARB_03491

ath:AT1G58280

ath:AT2G17280

ath:AT5G64460

spo:2541759

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · TkA04G441800 · TK1151

Nucleus0.498

Rank 2 · TkA04G441800 · TK1151

Mitochondrion0.083

Rank 3 · TkA04G441800 · TK1151

Cell membrane0.062

Rank 4 · TkA04G441800 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA04G441800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00300His_Phos_116-90 aa

PF26827Phage_T4_Y16B51-73 aa

PF26827Phage_T4_Y16B94-98 aa

PF00300His_Phos_1171-215 aa

PF26827Phage_T4_Y16B225-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G441800	`PF00300`	His_Phos_1	16	90	6.1e-11	43.1
TkA04G441800	`PF26827`	Phage_T4_Y16B	51	73	0.47	11.2
TkA04G441800	`PF26827`	Phage_T4_Y16B	94	98	0.47	11.2
TkA04G441800	`PF00300`	His_Phos_1	171	215	6.1e-11	43.1
TkA04G441800	`PF26827`	Phage_T4_Y16B	225	235	0.47	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGF0`	Arabidopsis thaliana	sp\|Q9FGF0\|PGML1_ARATH Phosphoglycerate mutase-like protein 1	76.200%	Swiss-Prot	High
`Q8GY96`	Arabidopsis thaliana	sp\|Q8GY96\|PGM_ARATH Phosphoglycerate mutase-like protein	64.600%	Swiss-Prot	High
`F4IBB2`	Arabidopsis thaliana	sp\|F4IBB2\|PGML2_ARATH Phosphoglycerate mutase-like protein 2	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card