TkA04G434740 | RubberDandelionOmics

Gene overview

TkA04G434740

Reference: TK1151 Chr: Chr04 Coordinates: 109646023-109647090 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

705 bp · TkA04G434740|TK1151|cDNA

ATGGAATCTGTGTCTGCCCTTTTAGAAGGAGAAAGGAACTACTTTAGTGAAACATATAATGTGAGTGAAGAGGCTGATTTCATGGCACATTTACTTGGTAACTTTTCGAATAATTTACCTAAACATTCTTCCACTTTTGAAGACTCTTCTTCTGCATTTTGGTCACCTTCAATATCCATGCCTTGTTTCCAAGACACTTATACAGATAACAACACTCTTCTTTTTCCCACTTCAAGTGGTGAAAGTTACCCTTCAATGGG...

CDS

Download CDS FASTA

705 bp · TkA04G434740|TK1151|CDS

ATGGAATCTGTGTCTGCCCTTTTAGAAGGAGAAAGGAACTACTTTAGTGAAACATATAATGTGAGTGAAGAGGCTGATTTCATGGCACATTTACTTGGTAACTTTTCGAATAATTTACCTAAACATTCTTCCACTTTTGAAGACTCTTCTTCTGCATTTTGGTCACCTTCAATATCCATGCCTTGTTTCCAAGACACTTATACAGATAACAACACTCTTCTTTTTCCCACTTCAAGTGGTGAAAGTTACCCTTCAATGGG...

Protein

Download Protein FASTA

234 aa · TkA04G434740|TK1151|PROTEIN

MESVSALLEGERNYFSETYNVSEEADFMAHLLGNFSNNLPKHSSTFEDSSSAFWSPSISMPCFQDTYTDNNTLLFPTSSGESYPSMGSSKGNSVIPCFSKKRSFSFDDVQMGWKKTKFTNIHDSDDECNRPKEEAMVNSSCKKRANNGTATDSQSVYAKKRRERINERLRILQSLVPNGTKVDISTMLEEAVQYVKFLQLQIKLLSSDELWMYAPLAYNGMNIGLLDVNLPSPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G434740`
TK1151 ID	TkA04G434740
OH-1004 ID	LXL04_038495
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G434740

Location Chr04:109646023-109647090 (+)

Description Similar to BHLH84: Transcription factor bHLH84

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14760`	Transcription factor bHLH84.	No verified direct reference in this release
`At4g33880`	Transcription factor involved in the regulation of root hair elongation.	A mechanistic framework for auxin dependent Arabidopsis root hair elongation to low external phosphate.2018 · DOI: 10.1038/s41467-018-03851-3
`At1g27740`	Transcription factor involved in the regulation of root hair elongation.	A basic helix-loop-helix transcription factor controls cell growth and size in root hairs.2010 · DOI: 10.1038/ng.529 Intensity of a pulse of RSL4 transcription factor synthesis determines Arabidopsis root hair cell size.2015 · DOI: 10.1038/nplants.2015.138 ROOT HAIR DEFECTIVE SIX-LIKE4 (RSL4) promotes root hair elongation by transcriptionally regulating the expression of genes required for cell growth.2016 · DOI: 10.1111/nph.14095 A mechanistic framework for auxin dependent Arabidopsis root hair elongation to low external phosphate.2018 · DOI: 10.1038/s41467-018-03851-3
`At5g43175`	Transcription factor bHLH139.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0508500`	Transcription factor that acts as a regulator of iron homeostasis.	Identification of OsbHLH133 as a regulator of iron distribution between roots and shoots in Oryza sativa.2013 · DOI: 10.1111/j.1365-3040.2012.02569.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0009733 response to auxin Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048766 root hair initiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G27740

ath:AT2G14760

ath:AT4G33880

ath:AT5G43175

osa:107276670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA04G434740 · TK1151

Cytoplasm0.096

Rank 2 · TkA04G434740 · TK1151

Cell membrane0.024

Rank 3 · TkA04G434740 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA04G434740 · TK1151

Plastid0.011

Rank 5 · TkA04G434740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09808SNAPC196-125 aa

PF04281Tom22118-197 aa

PF09808SNAPC1151-179 aa

PF23177bHLH_IRO3153-205 aa

PF00010HLH159-199 aa

PF23173bHLH_SAC51159-204 aa

PF23176bHLH_LHW162-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G434740	`PF09808`	SNAPC1	96	125	0.23	12.2
TkA04G434740	`PF04281`	Tom22	118	197	0.024	15.2
TkA04G434740	`PF09808`	SNAPC1	151	179	0.23	12.2
TkA04G434740	`PF23177`	bHLH_IRO3	153	205	0.0033	18.5
TkA04G434740	`PF00010`	HLH	159	199	3.7e-09	37.0
TkA04G434740	`PF23173`	bHLH_SAC51	159	204	3.3e-08	34.0
TkA04G434740	`PF23176`	bHLH_LHW	162	199	6.4e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XHI9`	Arabidopsis thaliana	sp\|Q7XHI9\|BH084_ARATH Transcription factor bHLH84	83.100%	Swiss-Prot	Low
`Q84WK0`	Arabidopsis thaliana	sp\|Q84WK0\|RSL2_ARATH Transcription factor RSL2	80.900%	Swiss-Prot	Low
`Q8LEG1`	Arabidopsis thaliana	sp\|Q8LEG1\|RSL4_ARATH Transcription factor RSL3	81.900%	Swiss-Prot	Low
`Q3E7L7`	Arabidopsis thaliana	sp\|Q3E7L7\|BH139_ARATH Transcription factor bHLH139	78.600%	Swiss-Prot	Low
`Q2QQ32`	Oryza sativa subsp. japonica	sp\|Q2QQ32\|BH133_ORYSJ Transcription factor BHLH133	48.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card