TkA04G425560 | RubberDandelionOmics

Gene overview

TkA04G425560

Reference: TK1151 Chr: Chr04 Coordinates: 107368720-107374003 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1779 bp · TkA04G425560|TK1151|cDNA

CTTCCTATTCTTATGATTTTTTAATTTTGGTGCATATGCATTGTGAAGATACAAGATTGAAGGTTTGTGTGAAGGGTTCTCTAAAGAAACTCAAAAACATTGTATATGTCTTCTACAAGCAAAAGCATGTCAGGGCGCAGAGCGCAGTGTGCACGCCATTTGAATATACACCTCTTGACCAACTCGACCGCCATTCAAGCAAACCAATAAATTGGATAATCTTTCATCCCAATATATAGAAACATTCGTACGTATATATC...

CDS

Download CDS FASTA

1308 bp · TkA04G425560|TK1151|CDS

ATGCATTGTGAAGATACAAGATTGAAGGTTTGTGTGAAGGGTTCTCTAAAGAAACTCAAAAACATTGTATATGTCTTCTACAAGAGAATCAAATTTGGATGCAATGTGTCATTCGCAACTTTCCTCGTCACATTTTTCGTGATCACCTACGCTGCGGCACTCAAGGAAGGACAAACGTGCTTAAATAATAACGAATGTAACTCAGGATTACATTGTGAGGCTTGCGTCGCTGACGGCAATGTTCGTCCTCGGTGTACTCG...

Protein

Download Protein FASTA

435 aa · TkA04G425560|TK1151|PROTEIN

MHCEDTRLKVCVKGSLKKLKNIVYVFYKRIKFGCNVSFATFLVTFFVITYAAALKEGQTCLNNNECNSGLHCEACVADGNVRPRCTRLQPLSPVSKVKGLPFNRYSWLTTHNSFARLGERSDTGSVVLAPTNQQDSVSSQLDNGVRGLMLDMYDFENDIWLCHSFGGKCFNYTAFQPAINVLKEIREFLEKNPTEIITIIIEDYVTSQNGLTNVFNNAGLRKFWFPVNRMPSNGADWPTVDFMVKQNYRLVVFTSRSAKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G425560`
TK1151 ID	TkA04G425560
OH-1004 ID	LXL04_001616
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.600
Protein coverage (%)	TK1151 84.828 / OH-1004 84.055 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G425560

Location Chr04:107368720-107374003 (+)

Description Similar to At5g67130: PI-PLC X domain-containing protein At5g67130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67130`	PI-PLC X domain-containing protein At5g67130.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001616 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0008081 phosphoric diester hydrolase activity Molecular Function

KEGG gene cross-reference

abe:ARB_04618

abe:ARB_08043

ath:AT5G67130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.365

Rank 1 · TkA04G425560 · TK1151

Extracellular0.240

Rank 2 · TkA04G425560 · TK1151

Lysosome / Vacuole0.185

Rank 3 · TkA04G425560 · TK1151

Cytoplasm0.154

Rank 4 · TkA04G425560 · TK1151

Golgi apparatus0.126

Rank 5 · TkA04G425560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26178Rv2075c_cat100-208 aa

PF26146PI-PLC_X130-352 aa

PF00388PI-PLC-X131-207 aa

PF25506TIM-barrel_MTC6133-192 aa

PF10623PilI189-246 aa

PF25506TIM-barrel_MTC6232-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G425560	`PF26178`	Rv2075c_cat	100	208	6.9e-08	32.8
TkA04G425560	`PF26146`	PI-PLC_X	130	352	1e-23	84.9
TkA04G425560	`PF00388`	PI-PLC-X	131	207	0.0027	18.1
TkA04G425560	`PF25506`	TIM-barrel_MTC6	133	192	0.087	13.0
TkA04G425560	`PF10623`	PilI	189	246	0.24	11.7
TkA04G425560	`PF25506`	TIM-barrel_MTC6	232	258	0.087	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93XX5`	Arabidopsis thaliana	sp\|Q93XX5\|Y5713_ARATH PI-PLC X domain-containing protein At5g67130	51.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card