TkA04G424830 | RubberDandelionOmics

Gene overview

TkA04G424830

Reference: TK1151 Chr: Chr04 Coordinates: 107189518-107192512 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2327 bp · TkA04G424830|TK1151|cDNA

CATCAAAGTTGGATTATACTTGCAGACTGGGGTAAACCGAAGGGACCATTTCTGTAATTTACTTCAATAAATATTTATTTGATATTGGCGTGGCGTTAAAGGTCGCAAACGGAAGGTGGCCTCATCTTTTAGGTCAACCAATATTCAAGCTTCAGACCGCAAGCGTGGACTTCTTCCATGATCGATCATATTCATATGATCTCCAAGCTTCACACATTACTTTTTCCCCAAGTTTCCTCAACCTTTGCTTGAGCATTTTG...

CDS

Download CDS FASTA

1605 bp · TkA04G424830|TK1151|CDS

ATGGGTTTATTAAACCCTAATCAAAGACCATCAAGAGGCAATCCATCAGATTACCATGAACCTAGCACCAGTAGCAGCAACAGCGCATCAACGTCATCATCACCACCCAATACTCATAATTCGAGGAAAAAGTGGTCCAATCTGTTGCCTCTATTCCTAGTCCTTGTTTTTATAGCCGAGATCAGTTTCTTAGGTCGACTCGACTTGATTAAGAATGCCGATCTCCTGAATTCCTGGACCGAATCATTTTACCAGTTTAC...

Protein

Download Protein FASTA

534 aa · TkA04G424830|TK1151|PROTEIN

MGLLNPNQRPSRGNPSDYHEPSTSSSNSASTSSSPPNTHNSRKKWSNLLPLFLVLVFIAEISFLGRLDLIKNADLLNSWTESFYQFTTSSFSSSSLDSADETSMFGLSGTGLDVISSVDGGESCEEWLEREDSVQYSRDFKRDPVFVTGGEQEFKSCAVDCKFGFEKKKADAAFGLPNGGGTAGVLRSMESAQYYAENNLAMARRKGYDIIMTTSLSSDVPVGYFSWAEYDIMAPVKPKTEKALAAAFISNCAARNFRLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G424830`
TK1151 ID	TkA04G424830
OH-1004 ID	LXL04_038395
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G424830

Location Chr04:107189518-107192512 (-)

Description Similar to FUT12: Putative fucosyltransferase-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49710`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At3g19280`	Catalyzes the addition of fucose in alpha 1-3 linkage to the first GlcNAc residue next to the peptide chains in N-glycans.	Distantly related plant and nematode core α1,3-fucosyltransferases display similar trends in structure-function relationships.2011 · DOI: 10.1093/glycob/cwr056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038395 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006493 protein O-linked glycosylation Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0009312 oligosaccharide biosynthetic process Biological Process

GO:0042355 L-fucose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G49710

ath:AT3G19280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.662

Rank 1 · TkA04G424830 · TK1151

Endoplasmic reticulum0.166

Rank 2 · TkA04G424830 · TK1151

Cell membrane0.073

Rank 3 · TkA04G424830 · TK1151

Cytoplasm0.065

Rank 4 · TkA04G424830 · TK1151

Extracellular0.055

Rank 5 · TkA04G424830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016Exostosin_GT47236-328 aa

PF00852Glyco_transf_10241-408 aa

PF12906RINGv389-396 aa

PF12906RINGv409-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G424830	`PF03016`	Exostosin_GT47	236	328	0.046	13.8
TkA04G424830	`PF00852`	Glyco_transf_10	241	408	9.4e-33	114.1
TkA04G424830	`PF12906`	RINGv	389	396	3.8	8.4
TkA04G424830	`PF12906`	RINGv	409	432	3.8	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX97`	Arabidopsis thaliana	sp\|Q9FX97\|FUT12_ARATH Putative fucosyltransferase-like protein	66.700%	Swiss-Prot	High
`Q9LJK1`	Arabidopsis thaliana	sp\|Q9LJK1\|FUT11_ARATH Glycoprotein 3-alpha-L-fucosyltransferase FUT11	65.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card