TkA04G423920 | RubberDandelionOmics

Gene overview

TkA04G423920

Reference: TK1151 Chr: Chr04 Coordinates: 106890550-106896839 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1911 bp · TkA04G423920|TK1151|cDNA

TTCAGACTAGTATGATTACATACATATGTTTTTGTATTTTAAGATCATTTGGTAAAAGTTTCACTGGAAGATATATATCAACGGCCAACCACTCTTCCCCACATATTCCTCCCGCCCAATCTCTCCCAGAGAAAAAGAAGAAAACTTGATTAACAAACTCAAATTCAAATTGATGCCTCTCAATCTTCCCCACCATGTCCAACATATCTTCCTCCACTGGTTTCTTACAATTCCCATCTTCTCCCTCGCCGCCGGCCCTC...

CDS

Download CDS FASTA

1173 bp · TkA04G423920|TK1151|CDS

ATGCCTCTCAATCTTCCCCACCATGTCCAACATATCTTCCTCCACTGGTTTCTTACAATTCCCATCTTCTCCCTCGCCGCCGGCCCTCCTCCCCCTTCTCTTCGTGGTTACCTCATCAATTGCGGATCCAAATACGACATCAAACAAGATGGCATAACATACGTAAAGGACGAAGGCTACATCGTCGCCGGAAACCTAACAACCTTAAACCGGACGGATATCTTACCCGTTCTCACCACCCTCCGTTACTTTCCCTACGG...

Protein

Download Protein FASTA

390 aa · TkA04G423920|TK1151|PROTEIN

MPLNLPHHVQHIFLHWFLTIPIFSLAAGPPPPSLRGYLINCGSKYDIKQDGITYVKDEGYIVAGNLTTLNRTDILPVLTTLRYFPYGPGKHCYEFPVIKGGKFLIRTTYFYGRFDGGFEPPVFDQIVDGTKWSVVNTTEDYKKGLSSYYEIIVTAIGKTISVCLASNEHTKAPSSPFISLLEVISIDSSLYNSTDFKKYGLITVARTNFAADGDFVRFPDDPFNRYWQPFVDGNPTVQAHENVTSSEFWNRPPVKVFRSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G423920`
TK1151 ID	TkA04G423920
OH-1004 ID	LXL04_001193
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.500
Protein coverage (%)	TK1151 94.872 / OH-1004 58.386 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G423920

Location Chr04:106890550-106896839 (-)

Description Similar to At1g67720: Probable LRR receptor-like serine/threonine-protein kinase At1g67720

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14510`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510.	No verified direct reference in this release
`At2g14440`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440.	No verified direct reference in this release
`At1g28340`	Receptor-like protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001193 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05700

ath:AT1G67720

ath:AT2G14510

ath:AT3G21340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.520

Rank 1 · TkA04G423920 · TK1151

Cell membrane0.239

Rank 2 · TkA04G423920 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA04G423920 · TK1151

Cytoplasm0.084

Rank 4 · TkA04G423920 · TK1151

Lysosome / Vacuole0.046

Rank 5 · TkA04G423920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11721Malectin38-60 aa

PF12819Malectin_like39-360 aa

PF18223PilJ_C223-250 aa

PF18223PilJ_C269-316 aa

PF11721Malectin276-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G423920	`PF11721`	Malectin	38	60	0.0021	18.8
TkA04G423920	`PF12819`	Malectin_like	39	360	4.6e-64	217.5
TkA04G423920	`PF18223`	PilJ_C	223	250	0.002	19.1
TkA04G423920	`PF18223`	PilJ_C	269	316	0.002	19.1
TkA04G423920	`PF11721`	Malectin	276	320	0.0021	18.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQR3`	Arabidopsis thaliana	sp\|Q9ZQR3\|Y2451_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510	25.300%	Swiss-Prot	Low
`Q9ZQQ7`	Arabidopsis thaliana	sp\|Q9ZQQ7\|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440	25.300%	Swiss-Prot	Low
`F4HWL3`	Arabidopsis thaliana	sp\|F4HWL3\|RLP4_ARATH Receptor-like protein 4	27.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card