TkA04G418130 | RubberDandelionOmics

Gene overview

TkA04G418130

Reference: TK1151 Chr: Chr04 Coordinates: 105251490-105252680 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · TkA04G418130|TK1151|cDNA

ATGATCACCGTCTCGCCGGCACCTTCACCGAATTATAATCTTCATCGTCAAGCTCCAGCTTCAGCTCCGGCTTCATGGCTTCCTAATTCCTCGTCAAAACCGCCTGTTCGATTCAGCCCGCCTTTGATAGCTATGGTTGTGATCATCGCCACTGCTTTTATCACAATCACATACTCCCGAGCCATTTCCCGACGATTCCTCCGTTTACGACGGAGCTGGCGACAGTGGCGGAGACGGCGACGCCTTCTCCGTTCATACGT...

CDS

Download CDS FASTA

1191 bp · TkA04G418130|TK1151|CDS

ATGATCACCGTCTCGCCGGCACCTTCACCGAATTATAATCTTCATCGTCAAGCTCCAGCTTCAGCTCCGGCTTCATGGCTTCCTAATTCCTCGTCAAAACCGCCTGTTCGATTCAGCCCGCCTTTGATAGCTATGGTTGTGATCATCGCCACTGCTTTTATCACAATCACATACTCCCGAGCCATTTCCCGACGATTCCTCCGTTTACGACGGAGCTGGCGACAGTGGCGGAGACGGCGACGCCTTCTCCGTTCATACGT...

Protein

Download Protein FASTA

396 aa · TkA04G418130|TK1151|PROTEIN

MITVSPAPSPNYNLHRQAPASAPASWLPNSSSKPPVRFSPPLIAMVVIIATAFITITYSRAISRRFLRLRRSWRQWRRRRRLLRSYVPSSVGNGDIESPVYTGEELYDPTYGYQMFSPYGLDDAVIKTIPLSVHSRKSSVHECAVCLLEFEDNDCVRTLPVCYHAFHVECIDVWLRCHANCPLCRASVFRPESPFIPVMSARIRPNFEDVMIESPIIEPSPVPEHDQQVDSAVSVSEITQETSPLRIPSEDRFSRRDFLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G418130`
TK1151 ID	TkA04G418130
OH-1004 ID	LXL04_038327
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G418130

Location Chr04:105251490-105252680 (+)

Description Similar to ATL65: RING-H2 finger protein ATL65

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18930`	RING-H2 finger protein ATL65.	No verified direct reference in this release
`At5g17600`	RING-H2 finger protein ATL52.	No verified direct reference in this release
`At3g03550`	RING-H2 finger protein ATL51.	No verified direct reference in this release
`At1g23980`	RING-H2 finger protein ATL47.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0590900`	Possesses E3 ubiquitin-protein ligase in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038327 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031982 vesicle Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04360

ath:AT1G23980

ath:AT3G18930

ath:AT4G17905

dosa:Os04g0590900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.346

Rank 1 · TkA04G418130 · TK1151

Nucleus0.330

Rank 2 · TkA04G418130 · TK1151

Cytoplasm0.249

Rank 3 · TkA04G418130 · TK1151

Endoplasmic reticulum0.138

Rank 4 · TkA04G418130 · TK1151

Lysosome / Vacuole0.085

Rank 5 · TkA04G418130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07219HemY_N35-84 aa

PF12678zf-rbx1138-185 aa

PF05883Baculo_RING139-198 aa

PF13639zf-RING_2142-185 aa

PF17123zf-RING_11142-171 aa

PF13923zf-C3HC4_2142-184 aa

PF14634zf-RING_5142-185 aa

PF00097zf-C3HC4143-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G418130	`PF07219`	HemY_N	35	84	0.0017	19.1
TkA04G418130	`PF12678`	zf-rbx1	138	185	9.3e-09	36.1
TkA04G418130	`PF05883`	Baculo_RING	139	198	0.072	13.8
TkA04G418130	`PF13639`	zf-RING_2	142	185	2.8e-11	44.2
TkA04G418130	`PF17123`	zf-RING_11	142	171	9.5e-09	35.5
TkA04G418130	`PF13923`	zf-C3HC4_2	142	184	5.1e-05	23.7
TkA04G418130	`PF14634`	zf-RING_5	142	185	0.27	12.0
TkA04G418130	`PF00097`	zf-C3HC4	143	184	0.0011	19.5
TkA04G418130	`PF13445`	zf-RING_UBOX	143	182	1.9	9.3
TkA04G418130	`PF12861`	zf-ANAPC11	150	187	0.0015	19.3
TkA04G418130	`PF25143`	Zn_ribbon_IFT122_C	160	186	2.0	9.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67YI6`	Arabidopsis thaliana	sp\|Q67YI6\|ATL65_ARATH RING-H2 finger protein ATL65	44.000%	Swiss-Prot	Medium
`Q9LF64`	Arabidopsis thaliana	sp\|Q9LF64\|ATL52_ARATH RING-H2 finger protein ATL52	35.200%	Swiss-Prot	Low
`Q9SRQ8`	Arabidopsis thaliana	sp\|Q9SRQ8\|ATL51_ARATH RING-H2 finger protein ATL51	50.000%	Swiss-Prot	Low
`Q8GW38`	Arabidopsis thaliana	sp\|Q8GW38\|ATL47_ARATH RING-H2 finger protein ATL47	38.700%	Swiss-Prot	Low
`Q7XLY8`	Oryza sativa subsp. japonica	sp\|Q7XLY8\|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900	35.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card