TkA04G415000 | RubberDandelionOmics

Gene overview

TkA04G415000

Reference: TK1151 Chr: Chr04 Coordinates: 104538865-104546591 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1174 bp · TkA04G415000|TK1151|cDNA

TATGATAACAATACATTCATATCTATGGTAACCGAATTTTGCAACTTTTTAGGGCAATTTATTATTACGGGTCTCTAATTTCACTCCATTTTCTACATTTTTTACCCAATCTATACAGATGACATAAAGGCACTCAGGTTGATAACAACCATTAAAACTCCATACTTATCTGATGGAAGGTTTGAAGAGAGCAACAATGAGAAAAGTGAGGAAACAAGGGAAGCTTTTAAACTCTCCTTGAGATGTTTGCTTTCGGCCTG...

CDS

Download CDS FASTA

570 bp · TkA04G415000|TK1151|CDS

ATGGTTCAAGCTCTTGAACGACATCTTTTGCACAGCAATCTGGTCTTTCATTATCACAAGGTTGGACTGCGATTGCTTCTTTGCCCACTTGGATCCAACATTGTCCTGAAAACAGCATGCTGTTCTGTAGGAGTTATAATACCTGTTTACTCTACATTTAAAGCAATTGAGACAAATAATACAACTGATCAACAAAAGTGGCTTTTATACTGGGCAGCATATGGGAGTTTTAGCATAGCAGAAGCATTTGCAGACAAAAT...

Protein

Download Protein FASTA

189 aa · TkA04G415000|TK1151|PROTEIN

MVQALERHLLHSNLVFHYHKVGLRLLLCPLGSNIVLKTACCSVGVIIPVYSTFKAIETNNTTDQQKWLLYWAAYGSFSIAEAFADKIISWFPLYHHMKFAFLVWLQLPTTNGAKHIYMNHLRPFLLRHQANLDQIVGILYNETGKFVSAHEGEFRFIKAIVMKILISAKHIINDSSQPVPPPEGRAITD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G415000`
TK1151 ID	TkA04G415000
OH-1004 ID	LXL04_038298
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 74.074 / OH-1004 71.795 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G415000

Location Chr04:104538865-104546591 (+)

Description Similar to HVA22K: HVA22-like protein k

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36720`	HVA22-like protein k.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038298 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0090158 endoplasmic reticulum membrane organization Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

KEGG gene cross-reference

ath:AT4G36720

bta:617543

hsa:7905

pon:100174273

rno:364838

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.619

Rank 1 · TkA04G415000 · TK1151

Cytoplasm0.122

Rank 2 · TkA04G415000 · TK1151

Nucleus0.122

Rank 3 · TkA04G415000 · TK1151

Mitochondrion0.104

Rank 4 · TkA04G415000 · TK1151

Cell membrane0.059

Rank 5 · TkA04G415000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03134TB2_DP1_HVA2248-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G415000	`PF03134`	TB2_DP1_HVA22	48	124	2.9e-30	104.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLY8`	Arabidopsis thaliana	sp\|Q6NLY8\|HA22K_ARATH HVA22-like protein k	65.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card