TkA04G401060 | RubberDandelionOmics

Gene overview

TkA04G401060

Reference: TK1151 Chr: Chr04 Coordinates: 100873507-100875363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

720 bp · TkA04G401060|TK1151|cDNA

ATGGAAGAACCGTCTTCTTCGTCGTCGTCGTCGGTGAGTTCTGATTTTGCTCAATCAACGTGTTCATCGAACTATCTGAGGCAAAGAATCAAACAGTTGGCGGACAAGTCGGAGATACCAAAGTGGAGATGTGATAAGGAAGAAAGCGAGTGGATCACAATCAGAATCAATGAAGATGGTGATGGAAAAGCGAACTGTGGGTCGGTGACAGGTGTGGTGGATAACGAGATGGAGGTGGGCTGCACCATTAGTGGCGGTGA...

CDS

Download CDS FASTA

720 bp · TkA04G401060|TK1151|CDS

ATGGAAGAACCGTCTTCTTCGTCGTCGTCGTCGGTGAGTTCTGATTTTGCTCAATCAACGTGTTCATCGAACTATCTGAGGCAAAGAATCAAACAGTTGGCGGACAAGTCGGAGATACCAAAGTGGAGATGTGATAAGGAAGAAAGCGAGTGGATCACAATCAGAATCAATGAAGATGGTGATGGAAAAGCGAACTGTGGGTCGGTGACAGGTGTGGTGGATAACGAGATGGAGGTGGGCTGCACCATTAGTGGCGGTGA...

Protein

Download Protein FASTA

239 aa · TkA04G401060|TK1151|PROTEIN

MEEPSSSSSSSVSSDFAQSTCSSNYLRQRIKQLADKSEIPKWRCDKEESEWITIRINEDGDGKANCGSVTGVVDNEMEVGCTISGGEDDELFVSFVDTPKFSCRPIAVNVAIDIFPNQPSPAVTMLMCELTDEVVVESSISVKDRSHSHSDRPLQFSRVFTVGAKEIKKSKQGRVKMDVLPDILTLLMVSWTGSLRRNKVPVIETNNNKEEPKEADVGRGPGLVVVLGRNLYCPYTTKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G401060`
TK1151 ID	TkA04G401060
OH-1004 ID	LXL04_038177
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.000
Protein coverage (%)	TK1151 39.331 / OH-1004 24.668 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G401060`
Location	Chr04:100873507-100875363 (+)
Description	Similar to MAPKKK18: Mitogen-activated protein kinase kinase kinase 18
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038177` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000302 response to reactive oxygen species Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006970 response to osmotic stress Biological Process GO:0007165 signal transduction Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0010029 regulation of seed germination Biological Process
KEGG gene cross-reference	ath:AT1G05100 ath:AT1G54960 ath:AT2G32510 ath:AT3G50310 ddi:DDB_G0283265 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.373

Rank 1 · TkA04G401060 · TK1151

Nucleus0.372

Rank 2 · TkA04G401060 · TK1151

Cell membrane0.280

Rank 3 · TkA04G401060 · TK1151

Endoplasmic reticulum0.076

Rank 4 · TkA04G401060 · TK1151

Mitochondrion0.063

Rank 5 · TkA04G401060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15761IMUP5-49 aa

PF23974DUF730039-63 aa

PF15761IMUP164-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G401060	`PF15761`	IMUP	5	49	3.1	9.3
TkA04G401060	`PF23974`	DUF7300	39	63	0.099	13.2
TkA04G401060	`PF15761`	IMUP	164	164	3.1	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card