RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G400560
Reference: TK1151 Chr: Chr04 Coordinates: 100723056-100725406 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1969 bp · TkA04G400560|TK1151|cDNA

ATGATATTGACCAATTTAGATATATGTGGAAGTAAATTGTTTTTATTTCTATTTTCTTATTTAGTATTAAGTCTTCAGTCTCAACTTCCCCTTTTTATTGCCGAGTCCACTGCCCCTTTGAGACTTGATTTCTCTTTCTATCTTCATAAATGGCCAAACGATCAAGTGGACTCTCCTTTGATTCAGATCCCATCAGATTACTATTTCCACACAAACTCACCGTCATCAACTCTTTCCCGGACCGCCGCTCCACCACGTGG...

CDS

Download CDS FASTA

1731 bp · TkA04G400560|TK1151|CDS

ATGGCCAAACGATCAAGTGGACTCTCCTTTGATTCAGATCCCATCAGATTACTATTTCCACACAAACTCACCGTCATCAACTCTTTCCCGGACCGCCGCTCCACCACGTGGAGACCTATGGAGCCCGCCGGCAACGTCAACAGGTCCTCTTCACCGCCATCACCTACCACCATCCAATTCCCACTCAACCTCAACTGCAATCATGATCATCAAGAGAAACAGATTAACGAAATGGATTTCTTTTCCGATAAAAAACATGA...

Protein

Download Protein FASTA

576 aa · TkA04G400560|TK1151|PROTEIN

MAKRSSGLSFDSDPIRLLFPHKLTVINSFPDRRSTTWRPMEPAGNVNRSSSPPSPTTIQFPLNLNCNHDHQEKQINEMDFFSDKKHDEDRSRLPVSTSDPPPPVTELDFNINTGLHLVTGNTSSDQSVVDDGTSPNSEDKRAKNELAVVQAELERMNTENQRLREVLDQVTNNYNTLQTHLVTMMQQKQREEQSTEDHKTSNEGGEVMIVPRPFMDLGLAAPTAVETEEISQSSSDGHDEHSRSPTLHTNSTNIDHREES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G400560
TK1151 IDTkA04G400560
OH-1004 IDLXL04_038164
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.600
Protein coverage (%)TK1151 94.271 / OH-1004 94.271
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G400560
LocationChr04:100723056-100725406 (+)
DescriptionSimilar to WRKY6: WRKY transcription factor 6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g62300 Transcription factor involved in the control of processes related to senescence and pathogen defense.
Targets of AtWRKY6 regulation during plant senescence and pathogen defense.2002 · DOI: 10.1101/gad.222702
WRKY42 modulates phosphate homeostasis through regulating phosphate translocation and acquisition in Arabidopsis.2015 · DOI: 10.1104/pp.114.253799
At4g04450 Transcription factor.
WRKY42 modulates phosphate homeostasis through regulating phosphate translocation and acquisition in Arabidopsis.2015 · DOI: 10.1104/pp.114.253799
At4g22070 Transcription factor. No verified direct reference in this release
At4g01720 Transcription factor. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0137500 Transcription factor that acts as a positive regulator of leaf senescence.
OsWRKY5 Promotes Rice Leaf Senescence via Senescence-Associated NAC and Abscisic Acid Biosynthesis Pathway.2019 · DOI: 10.3390/ijms20184437
Inactivating transcription factor OsWRKY5 enhances drought tolerance through abscisic acid signaling pathways.2022 · DOI: 10.1093/plphys/kiab492
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038164 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0016036 cellular response to phosphate starvation Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0080169 cellular response to boron-containing substance deprivation Biological Process
GO:1900057 positive regulation of leaf senescence Biological Process
GO:1901527 abscisic acid-activated signaling pathway involved in stomatal movement Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT1G62300
ath:AT4G01720
ath:AT4G04450
ath:AT4G22070
osa:107276141
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973
Rank 1 · TkA04G400560 · TK1151
Cytoplasm0.089
Rank 2 · TkA04G400560 · TK1151
Cell membrane0.023
Rank 3 · TkA04G400560 · TK1151
Endoplasmic reticulum0.013
Rank 4 · TkA04G400560 · TK1151
Plastid0.010
Rank 5 · TkA04G400560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24319DUF749173-86 aa
PF26095CC_Bre1128-179 aa
PF15039DUF4530133-200 aa
PF06785UPF0242136-190 aa
PF05266DUF724137-203 aa
PF24319DUF7491140-187 aa
PF06818Fez1140-200 aa
PF15233SYCE1144-199 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G400560PF24319DUF749173860.5411.2
TkA04G400560PF26095CC_Bre11281790.113.6
TkA04G400560PF15039DUF45301332000.07613.9
TkA04G400560PF06785UPF02421361900.1612.8
TkA04G400560PF05266DUF7241372030.5410.8
TkA04G400560PF24319DUF74911401870.5411.2
TkA04G400560PF06818Fez11402001.210.3
TkA04G400560PF15233SYCE11441990.0414.7
TkA04G400560PF09726Macoilin1491964.76.4
TkA04G400560PF07875Coat_F1581880.3112.0
TkA04G400560PF09726Macoilin2292954.76.4
TkA04G400560PF26095CC_Bre12432920.113.6
TkA04G400560PF03106WRKY3163735.4e-2691.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C519Arabidopsis thalianasp|Q9C519|WRKY6_ARATH WRKY transcription factor 647.900%Swiss-ProtMedium
Q9XEC3Arabidopsis thalianasp|Q9XEC3|WRK42_ARATH WRKY transcription factor 4249.200%Swiss-ProtMedium
Q93WT0Arabidopsis thalianasp|Q93WT0|WRK31_ARATH Probable WRKY transcription factor 3145.100%Swiss-ProtMedium
Q9ZSI7Arabidopsis thalianasp|Q9ZSI7|WRK47_ARATH Probable WRKY transcription factor 4741.400%Swiss-ProtMedium
Q75L34Oryza sativa subsp. japonicasp|Q75L34|WRKY5_ORYSJ Transcription factor WRKY539.600%Swiss-ProtMedium

JBrowse

View in Genome Browser