TkA04G395490 | RubberDandelionOmics

Gene overview

TkA04G395490

Reference: TK1151 Chr: Chr04 Coordinates: 99504697-99505601 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · TkA04G395490|TK1151|cDNA

ATGAATGGTGTCCAGAGTTATGCAGCAATTTTGTACCTGTGCATTCCAGAGGGCTTTAGGATGATCCTGCGTGGAAAAGATGTGAAGTATCATAATATAGTGGATGACCTGATGCTAACTCAGAAGATGGTGGCTGAGGTGACTCTAGGCTTTGTGAAAGATGCAAAAAAACACATCGATGTTCAAGGCTACAATGTTTATCATAAGAACCGACTCATTAAGCCATTTTGGAGGGTTTGGAATGCTGCTGGAAGTGATGG...

CDS

Download CDS FASTA

633 bp · TkA04G395490|TK1151|CDS

ATGAATGGTGTCCAGAGTTATGCAGCAATTTTGTACCTGTGCATTCCAGAGGGCTTTAGGATGATCCTGCGTGGAAAAGATGTGAAGTATCATAATATAGTGGATGACCTGATGCTAACTCAGAAGATGGTGGCTGAGGTGACTCTAGGCTTTGTGAAAGATGCAAAAAAACACATCGATGTTCAAGGCTACAATGTTTATCATAAGAACCGACTCATTAAGCCATTTTGGAGGGTTTGGAATGCTGCTGGAAGTGATGG...

Protein

Download Protein FASTA

210 aa · TkA04G395490|TK1151|PROTEIN

MNGVQSYAAILYLCIPEGFRMILRGKDVKYHNIVDDLMLTQKMVAEVTLGFVKDAKKHIDVQGYNVYHKNRLIKPFWRVWNAAGSDGRGVIGVLEADFVEPAHDKQGFKRTIVLSRLENRLVIIQKRFWSTNSQEIGYAKRCKSSNSGTKCRPSMVEEKPDVQSDARAKLRPIRKTPQPEVEEYSVQVHHRKNLNRKRLQIRDKRKSDAQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G395490`
TK1151 ID	TkA04G395490
OH-1004 ID	LXL04_011732
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.800
Protein coverage (%)	TK1151 86.667 / OH-1004 29.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G395490

Location Chr04:99504697-99505601 (-)

Description Similar to MORC7: Protein MICRORCHIDIA 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50780`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At4g24970`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At5g13130`	Exhibits ATPase activity.	No verified direct reference in this release
`At1g19100`	Involved in RNA-directed DNA methylation (RdDM) as a component of the RdDM machinery and required for gene silencing.	MORC family ATPases required for heterochromatin condensation and gene silencing.2012 · DOI: 10.1126/science.1221472 Involvement of a GHKL ATPase in RNA-directed DNA methylation in Arabidopsis thaliana.2012 · DOI: 10.1016/j.cub.2012.03.061 The stochastic silencing phenotype of Arabidopsis morc6 mutants reveals a role in efficient RNA-directed DNA methylation.2013 · DOI: 10.1111/tpj.12246 Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998 Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1006026
`At4g36270`	Exhibits ATPase activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011732 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0098542 defense response to other organism Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1901672 positive regulation of systemic acquired resistance Biological Process

KEGG gene cross-reference

ath:AT4G24970

ath:AT4G36280

ath:AT5G13130

ath:AT5G50780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA04G395490 · TK1151

Cytoplasm0.109

Rank 2 · TkA04G395490 · TK1151

Cell membrane0.024

Rank 3 · TkA04G395490 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA04G395490 · TK1151

Mitochondrion0.014

Rank 5 · TkA04G395490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17942Morc6_S55-129 aa

PF06322Phage_NinH14-40 aa

PF06322Phage_NinH53-68 aa

PF06322Phage_NinH177-198 aa

PF17942Morc6_S5180-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G395490	`PF17942`	Morc6_S5	5	129	9.4e-48	162.5
TkA04G395490	`PF06322`	Phage_NinH	14	40	0.46	11.1
TkA04G395490	`PF06322`	Phage_NinH	53	68	0.46	11.1
TkA04G395490	`PF06322`	Phage_NinH	177	198	0.46	11.1
TkA04G395490	`PF17942`	Morc6_S5	180	199	9.4e-48	162.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAF2`	Arabidopsis thaliana	sp\|F4KAF2\|MORC4_ARATH Protein MICRORCHIDIA 4	57.700%	Swiss-Prot	High
`F4JRS4`	Arabidopsis thaliana	sp\|F4JRS4\|MORC7_ARATH Protein MICRORCHIDIA 7	63.900%	Swiss-Prot	Medium
`F4K2G3`	Arabidopsis thaliana	sp\|F4K2G3\|MORC5_ARATH Protein MICRORCHIDIA 5	59.000%	Swiss-Prot	Medium
`Q56Y74`	Arabidopsis thaliana	sp\|Q56Y74\|MORC6_ARATH Protein MICRORCHIDIA 6	48.600%	Swiss-Prot	Medium
`F4JPP0`	Arabidopsis thaliana	sp\|F4JPP0\|MORC3_ARATH Protein MICRORCHIDIA 3	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card