LXL04_011732 | RubberDandelionOmics

Gene overview

LXL04_011732

Reference: OH-1004 Chr: Chr02 Coordinates: 170404556-170408288 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2103 bp · LXL04_011732|LXL04_011732|OH1004|cDNA

ATGGCAACAGTTTCGACGAACATGGGAATGATCGACGTTCTTGATTCTAATCGGAGTTTCCACTGTAGCCATGGTGCTGATGTTACGGACGAGAATAACGGGAGGCCGAATAAAAAGCCGAAAATCGAAGAACAAGTAGTTGAATATGCGTTGCCTCTAGGGTTTCTTGATCCCATTAATCACCAGGAACGCTCGATAGTCTGTATTCCGCAGTCCATCTTAGAATACCAAAACAGTGATCACAATCTGAAGGCTGTTGT...

CDS

Download CDS FASTA

2103 bp · LXL04_011732|LXL04_011732|OH1004|CDS

ATGGCAACAGTTTCGACGAACATGGGAATGATCGACGTTCTTGATTCTAATCGGAGTTTCCACTGTAGCCATGGTGCTGATGTTACGGACGAGAATAACGGGAGGCCGAATAAAAAGCCGAAAATCGAAGAACAAGTAGTTGAATATGCGTTGCCTCTAGGGTTTCTTGATCCCATTAATCACCAGGAACGCTCGATAGTCTGTATTCCGCAGTCCATCTTAGAATACCAAAACAGTGATCACAATCTGAAGGCTGTTGT...

Protein

Download Protein FASTA

700 aa · LXL04_011732|LXL04_011732|OH1004|PROTEIN

MATVSTNMGMIDVLDSNRSFHCSHGADVTDENNGRPNKKPKIEEQVVEYALPLGFLDPINHQERSIVCIPQSILEYQNSDHNLKAVVPSLSKQFWKAGDYDDSVSKSESIAHPAVGMDHVRVHPRFLHSNATSHKWALGAFAELLDNSLDEVRTGATYVNVDVLNNDTGGKMLLVEDNGGGMTPDKLRGCMSLGYSVKSRLANTIGQYGNGFKTSTMRLGADVLVFTRCPGHDGTSWLLYLASSTQSIGMLSYTFLMETG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011732`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011732

Location Chr02:170404556-170408288 (+)

Description Similar to MORC7: Protein MICRORCHIDIA 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24970`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At5g50780`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At5g13130`	Exhibits ATPase activity.	No verified direct reference in this release
`At4g36280`	Mediator of defense signaling triggered by distinct classes of R proteins.	Endosome-associated CRT1 functions early in resistance gene-mediated defense signaling in Arabidopsis and tobacco.2010 · DOI: 10.1105/tpc.109.071662 CRT1 is a nuclear-translocated MORC endonuclease that participates in multiple levels of plant immunity.2012 · DOI: 10.1038/ncomms2279 Transcriptional gene silencing by Arabidopsis microrchidia homologues involves the formation of heteromers.2014 · DOI: 10.1073/pnas.1406611111
`At1g19100`	Involved in RNA-directed DNA methylation (RdDM) as a component of the RdDM machinery and required for gene silencing.	MORC family ATPases required for heterochromatin condensation and gene silencing.2012 · DOI: 10.1126/science.1221472 Involvement of a GHKL ATPase in RNA-directed DNA methylation in Arabidopsis thaliana.2012 · DOI: 10.1016/j.cub.2012.03.061 The stochastic silencing phenotype of Arabidopsis morc6 mutants reveals a role in efficient RNA-directed DNA methylation.2013 · DOI: 10.1111/tpj.12246 Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998 Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1006026

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011732 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0098542 defense response to other organism Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1901672 positive regulation of systemic acquired resistance Biological Process

KEGG gene cross-reference

ath:AT4G24970

ath:AT4G36280

ath:AT5G13130

ath:AT5G50780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.875

Rank 1 · LXL04_011732 · OH-1004

Cytoplasm0.147

Rank 2 · LXL04_011732 · OH-1004

Cell membrane0.038

Rank 3 · LXL04_011732 · OH-1004

Mitochondrion0.028

Rank 4 · LXL04_011732 · OH-1004

Plastid0.023

Rank 5 · LXL04_011732 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13589.13HATPase_c_3139-237 aa

PF17942.9Morc6_S5375-522 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011732	`PF13589.13`	HATPase_c_3	139	237	3.9e-17	63.3
LXL04_011732	`PF17942.9`	Morc6_S5	375	522	2.6e-56	190.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JRS4`	Arabidopsis thaliana	Protein MICRORCHIDIA 7	59.370%	Swiss-Prot	strong database homology
`F4KAF2`	Arabidopsis thaliana	Protein MICRORCHIDIA 4	61.296%	Swiss-Prot	strong database homology
`F4K2G3`	Arabidopsis thaliana	Protein MICRORCHIDIA 5	51.406%	Swiss-Prot	strong database homology
`Q5FV35`	Arabidopsis thaliana	Protein MICRORCHIDIA 2	41.265%	Swiss-Prot	moderate database homology
`Q56Y74`	Arabidopsis thaliana	Protein MICRORCHIDIA 6	48.649%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card