TkA04G381490 | RubberDandelionOmics

Gene overview

TkA04G381490

Reference: TK1151 Chr: Chr04 Coordinates: 96068062-96068871 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA04G381490|TK1151|cDNA

TGTAGTAGCGAGCTTTCTCTTTTCTTTGAAAATGGTCCTTTCAAAATCGGAGATAACCTGATTCTTGTCTGGAACGAGTATGGGTGGGACAAGGCATCAAATATAATATATGGTGAACAACCTACTGGAACAGGGTTTAGTTATAGCATTGATAAAAGAGACATTCGGCAGGATGAACAAGATAAAGAGTTTGGAACTCGTGTTTTGAGGATAAATGTTGGACATGATCACAATGATTATCTTCTTGCGAGAAAATTAGG...

CDS

Download CDS FASTA

360 bp · TkA04G381490|TK1151|CDS

TGTAGTAGCGAGCTTTCTCTTTTCTTTGAAAATGGTCCTTTCAAAATCGGAGATAACCTGATTCTTGTCTGGAACGAGTATGGGTGGGACAAGGCATCAAATATAATATATGGTGAACAACCTACTGGAACAGGGTTTAGTTATAGCATTGATAAAAGAGACATTCGGCAGGATGAACAAGATAAAGAGTTTGGAACTCGTGTTTTGAGGATAAATGTTGGACATGATCACAATGATTATCTTCTTGCGAGAAAATTAGG...

Protein

Download Protein FASTA

119 aa · TkA04G381490|TK1151|PROTEIN

CSSELSLFFENGPFKIGDNLILVWNEYGWDKASNIIYGEQPTGTGFSYSIDKRDIRQDEQDKEFGTRVLRINVGHDHNDYLLARKLGLPILNVMNKDGTLNELIAFGDQAVVCDHGAFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G381490`
TK1151 ID	TkA04G381490
OH-1004 ID	LXL04_008095
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	87.500
Protein coverage (%)	TK1151 60.504 / OH-1004 72.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G381490

Location Chr04:96068062-96068871 (+)

Description Similar to EMB2247: Valine--tRNA ligase, chloroplastic/mitochondrial 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10410`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g45010`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0479300`	Serine carboxypeptidase-like.	No verified direct reference in this release
`Os02g0114200`	Serine carboxypeptidase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008095 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006438 valyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0004832 valine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G16715

fnu:FN2011

smu:SMU_1770

tde:TDE_1364

uur:UU267

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.571

Rank 1 · TkA04G381490 · TK1151

Nucleus0.527

Rank 2 · TkA04G381490 · TK1151

Mitochondrion0.051

Rank 3 · TkA04G381490 · TK1151

Extracellular0.037

Rank 4 · TkA04G381490 · TK1151

Cell membrane0.034

Rank 5 · TkA04G381490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S101-60 aa

PF13603tRNA-synt_1_274-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G381490	`PF00450`	Peptidase_S10	1	60	4.4e-17	63.3
TkA04G381490	`PF13603`	tRNA-synt_1_2	74	102	0.22	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P32826`	Arabidopsis thaliana	sp\|P32826\|SCP49_ARATH Serine carboxypeptidase-like 49	67.800%	Swiss-Prot	Low
`Q56WF8`	Arabidopsis thaliana	sp\|Q56WF8\|SCP48_ARATH Serine carboxypeptidase-like 48	66.100%	Swiss-Prot	Low
`P52712`	Oryza sativa subsp. japonica	sp\|P52712\|CBPX_ORYSJ Serine carboxypeptidase-like	69.500%	Swiss-Prot	Low
`P37891`	Oryza sativa subsp. japonica	sp\|P37891\|CBP3_ORYSJ Serine carboxypeptidase 3	66.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card