TkA04G376720 | RubberDandelionOmics

Gene overview

TkA04G376720

Reference: TK1151 Chr: Chr04 Coordinates: 94913139-94916000 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1257 bp · TkA04G376720|TK1151|cDNA

GCATTGACAAGACAAGATGAAGATGGAGAGAAGCAAAGATGGAATATTTGGACTTGGTCAAATGTTGAGATTCCAAGATCGCCTTCATGCTCATGCTTATTTCCGCAAGGCTGCTGCTGGAGCCATCAGGAGGCGGAAGTGAAGAATGAGGAAGCTAATGCTGGTGGTGCTTCCAAATATGGGAAAAGAAATGTTAAGGCAGTTGATCCGGATCCACATGGCGAGAAGTTATTACAGATGGAATCCCAAATTCATTACCT...

CDS

Download CDS FASTA

1257 bp · TkA04G376720|TK1151|CDS

GCATTGACAAGACAAGATGAAGATGGAGAGAAGCAAAGATGGAATATTTGGACTTGGTCAAATGTTGAGATTCCAAGATCGCCTTCATGCTCATGCTTATTTCCGCAAGGCTGCTGCTGGAGCCATCAGGAGGCGGAAGTGAAGAATGAGGAAGCTAATGCTGGTGGTGCTTCCAAATATGGGAAAAGAAATGTTAAGGCAGTTGATCCGGATCCACATGGCGAGAAGTTATTACAGATGGAATCCCAAATTCATTACCT...

Protein

Download Protein FASTA

418 aa · TkA04G376720|TK1151|PROTEIN

ALTRQDEDGEKQRWNIWTWSNVEIPRSPSCSCLFPQGCCWSHQEAEVKNEEANAGGASKYGKRNVKAVDPDPHGEKLLQMESQIHYLEQVAYSSVLPAFKAQSDALSWEKEGLITELRKELRVSDDEHRELLSDDIIIRIREGKGAVQKKVNALRELRRLLSKSGAIPLLAQCLSFGSQDEQFLEAAWCLTNIAAGKPEETRALLPALPLLIAYIGEKSSVPVAEQCAWAIGNVAGEGDELRQILISQGALLPLAKMMLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G376720`
TK1151 ID	TkA04G376720
OH-1004 ID	LXL04_006550
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 69.856 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G376720

Location Chr04:94913139-94916000 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03070`	Binds to conventional NLS motifs and mediates nuclear protein import across the nuclear envelope (By similarity).	No verified direct reference in this release
`At5g13020`	Probably involved in the regulation of chromatin states (Probable).	No verified direct reference in this release
`At3g12140`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123
`At2g44440`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0158000`	Binds specifically and directly to substrates containing either a simple or bipartite NLS motif.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006550 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042564 NLS-dependent protein nuclear import complex Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0008139 nuclear localization sequence binding Molecular Function

GO:0031491 nucleosome binding Molecular Function

KEGG gene cross-reference

ath:AT2G44440

ath:AT3G12140

ath:AT5G03070

ath:AT5G13020

dosa:Os01g0158000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.383

Rank 1 · TkA04G376720 · TK1151

Nucleus0.354

Rank 2 · TkA04G376720 · TK1151

Cell membrane0.151

Rank 3 · TkA04G376720 · TK1151

Endoplasmic reticulum0.124

Rank 4 · TkA04G376720 · TK1151

Mitochondrion0.101

Rank 5 · TkA04G376720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03735ENT79-144 aa

PF00514Arm156-195 aa

PF30746TMCO6178-256 aa

PF13513HEAT_EZ185-234 aa

PF00514Arm207-235 aa

PF00514Arm239-259 aa

PF00514Arm275-290 aa

PF03735ENT284-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G376720	`PF03735`	ENT	79	144	1.8e-22	79.8
TkA04G376720	`PF00514`	Arm	156	195	4.8e-09	36.7
TkA04G376720	`PF30746`	TMCO6	178	256	8.9e-06	25.4
TkA04G376720	`PF13513`	HEAT_EZ	185	234	0.00025	22.2
TkA04G376720	`PF00514`	Arm	207	235	4.8e-09	36.7
TkA04G376720	`PF00514`	Arm	239	259	4.8e-09	36.7
TkA04G376720	`PF00514`	Arm	275	290	4.8e-09	36.7
TkA04G376720	`PF03735`	ENT	284	301	1.8e-22	79.8
TkA04G376720	`PF00515`	TPR_1	332	352	0.058	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KF65`	Arabidopsis thaliana	sp\|F4KF65\|IMPA9_ARATH Importin subunit alpha-9	57.600%	Swiss-Prot	Low
`F4K2F0`	Arabidopsis thaliana	sp\|F4K2F0\|EML3_ARATH Protein EMSY-LIKE 3	49.200%	Swiss-Prot	Low
`Q9C7C4`	Arabidopsis thaliana	sp\|Q9C7C4\|EML1_ARATH Protein EMSY-LIKE 1	77.600%	Swiss-Prot	Low
`Q08A72`	Arabidopsis thaliana	sp\|Q08A72\|EML4_ARATH Protein EMSY-LIKE 4	57.800%	Swiss-Prot	Low
`Q9FYP9`	Oryza sativa subsp. japonica	sp\|Q9FYP9\|IMAP2_ORYSJ Importin subunit alpha-2	48.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card